(data stored in ACNUC7421 zone)

EMBL: CP001053.PE266

CP001053.PE266       Location/Qualifiers
FT   CDS_pept        309881..310831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4263"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mms:mma_1670 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4263"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18641"
FT                   /db_xref="GOA:B2TEX0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX0"
FT                   /protein_id="ACD18641.1"
FT                   /translation="MQLDMRLVMAFSLVMRSGSLTQAEAISGVSKATLSRQLQVLEEEL
FT                   GVTLFNRRARGMSPTEAARAFHTHCEQILADVSGRLEVAREQLQELGSGIGGELSIKAD
FT                   SEFSTTFAAHVTKLFMARHPNVKLNLDVADYPGCAKAEEIDGYICAELPDIPDLVGKLL
FT                   GQISCGLYASPAYLKQKGTPVTPMDLTCHDSIVIRSTSGNKDTLMLYSQGGSQPYLPKA
FT                   NVTTNDHWIMKTFCIDGFGIALLPDFFVQPELSQQLLVPVLPEWKPQPRRIYCAYQKQR
FT                   FAGRKLSDLITLMADCIKDIDTFSGYVGRSSSGSS"
     atgcagttgg atatgagact ggtcatggcg ttctcgctcg tcatgcgaag cgggagcctc        60
     acgcaggcgg aagccatcag tggcgtctcg aaggcgacgc tgagccgcca gttacaagtg       120
     ctggaggagg agctgggcgt tacgctgttc aaccggcgtg cccgtggcat gagcccgacg       180
     gaggcggcgc gggcctttca tacgcattgc gagcaaatcc tggctgacgt ctccggacga       240
     ctggaagtcg cccgcgagca acttcaggag ctgggttccg gcattggcgg cgagctgtcg       300
     atcaaggccg acagcgaatt cagtaccact ttcgccgcac atgtcaccaa gctgtttatg       360
     gcgcggcatc cgaatgtgaa gctcaacctc gacgttgccg actaccctgg ctgcgccaaa       420
     gcggaggaaa tcgacggcta catctgcgcc gagctgccgg acattccgga cctcgtcggc       480
     aagctgcttg ggcaaatcag ctgcgggcta tacgccagcc ccgcctacct gaagcagaag       540
     ggtacccctg taacgccgat ggacctgacg tgccatgatt ccatcgtgat ccggtcgacc       600
     agcgggaaca aggacaccct gatgctgtat tcgcaaggcg gaagtcaacc ctaccttccc       660
     aaagccaatg tcacgaccaa cgaccattgg atcatgaaga cgttctgcat tgacggattt       720
     ggcatcgccc tgttgccaga tttcttcgtg cagccggagt tgagccaaca actgctcgtt       780
     ccggtattgc cagagtggaa gccgcaaccc aggcgcattt actgtgctta tcagaagcag       840
     cgctttgccg gaagaaagct cagcgacttg atcacgctaa tggccgattg tattaaggac       900
     atcgatacct tttccggcta tgtcggcaga agctcctctg gcagcagcta g                951
//

If you have problems or comments...

PBIL Back to PBIL home page