(data stored in ACNUC7421 zone)

EMBL: CP001053.PE267

CP001053.PE267       Location/Qualifiers
FT   CDS_pept        310978..311538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4264"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bvi:Bcep1808_7045 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4264"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18642"
FT                   /db_xref="GOA:B2TEX1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX1"
FT                   /protein_id="ACD18642.1"
FT                   /translation="MLKAGSAVDATLIAAPSLTKNGCGTRDPGMQSTQKGGNWYFGMKM
FT                   HVGVDADSGLVHTFIGTAVDVHDFNVAQALLHGEETDVYADAGHQGIGKRSGTDAVRWH
FT                   VAMRPAKRRKLDPSDSLDAIYDQIARLKAGVRAKVEHPLSILKRQFGYLKMPYRGLMKN
FT                   TAQITILFALGNLWMARSALRKA"
     atgcttaagg ctgggtcggc agtcgacgcc accctgattg ccgcgcccag tttgacaaag        60
     aatggctgcg gcacacgcga tccgggaatg caatccacgc agaaaggtgg caactggtac       120
     ttcgggatga aaatgcacgt cggcgtggac gccgactcgg gcctcgtcca tacgttcatt       180
     ggaacggcgg tcgatgttca cgacttcaac gtagcccaag cgttgctgca cggtgaagaa       240
     acggatgtgt acgcggacgc cggtcaccag ggtatcggaa agcgcagcgg gactgacgcg       300
     gttcgctggc atgttgcaat gcgaccggca aagcgcagga aactggatcc gagtgattcg       360
     ttggacgcga tctacgatca gattgcacgc ctgaaagcgg gtgttcgggc caaagtcgaa       420
     cacccgctta gcatcctcaa gcggcagttc gggtacctga aaatgcccta tcgcggtttg       480
     atgaagaaca ctgcccagat caccatcctg tttgctttgg gcaatttgtg gatggcgcgt       540
     agcgctttgc gcaaagcttg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page