(data stored in ACNUC7421 zone)

EMBL: CP001053.PE269

CP001053.PE269       Location/Qualifiers
FT   CDS_pept        complement(315315..317000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4267"
FT                   /product="phosphoesterase"
FT                   /note="PFAM: phosphoesterase; KEGG: bmn:BMA10247_A1822
FT                   phosphoesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4267"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18644"
FT                   /db_xref="GOA:B2TEX3"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX3"
FT                   /protein_id="ACD18644.1"
FT                   /translation="MFSRAFLFGVSGIAMAVSLYACGGSGSNGLTPVSAQNQLTTATPI
FT                   KHVVVIYNENVSFDHYFATYPNATNPSGEPAFTAAAGTPSVNGLSGTLLTNNPNFINTL
FT                   NGAGATNPFRLDRTQAATADQNHAYTAEQQAYNNGAADLFPKFTGKGSSGGAGAFATTG
FT                   QVMGYYDGNTVTAMWNWAQHFAMSDNAYTDTFGPSTPGALEVVAGQTNGVQLVKTSQQP
FT                   FNLTTASHSYYVNDGQGGVTLINDVDPANDLCSSTTDQILMSGKNIGDLLNAKGITWGG
FT                   FMGGFNLATTNSNGTTGCKRSTVTPAVGQPTADYIPHHNWFQYYASTANPQHLRPSATA
FT                   AIGYTLQSDGKTVDPANHQYDSDDFFAAVKAGNYPSVSFIKAPAFQDGHAGYSDPLDEQ
FT                   AFTAKVVNFLQQQPDWKSTAVIVAWDDSDGWYDHAYANPTSSSFDAQADQLNGAGKCGT
FT                   GTAPNGVNGAAVNGRCGPGTRIPFLVISPWAKVNYVDHTPISQASVVRFIEDNWLGSQR
FT                   IGGGSFDATAGSIMGLFNFSGSGNNPTVFVDPNLGSVVSSVPAI"
     atgttttccc gagctttcct gtttggtgta tcaggcatcg caatggcagt ctcactgtac        60
     gcatgcggtg gcagcggttc aaatgggctt acgcccgtga gcgcacaaaa tcagttgacg       120
     acggcgacgc ccatcaaaca cgtcgttgtg atttacaacg agaacgtctc tttcgaccac       180
     tacttcgcaa cctacccgaa tgcgacgaat ccgtcgggtg aacccgcgtt cacggccgcc       240
     gcgggcacgc cgtcggtgaa tggtttgagc ggcacattgc tgaccaacaa tccaaacttc       300
     atcaatacgc tgaacggcgc gggcgccacg aatccgttcc ggctggaccg tacgcaagcg       360
     gcgacggccg accagaatca cgcttacacc gcggaacagc aagcgtataa caatggggcg       420
     gcggacctgt tcccgaagtt cacgggtaag ggctcgagcg gtggcgcagg cgcttttgct       480
     acgaccggac aggtaatggg ctactacgac ggcaacaccg tcaccgccat gtggaactgg       540
     gctcagcact tcgcgatgag cgacaacgct tacaccgata cgttcggacc gtcgacgccc       600
     ggtgcactgg aagttgtcgc aggccagacg aacggcgtgc aactcgtcaa aaccagccag       660
     cagcctttca atctgacgac agcctcgcac tcttactacg tcaatgacgg gcagggaggc       720
     gtgacattaa tcaacgatgt cgacccggca aacgacctgt gctccagcac gaccgaccag       780
     attcttatgt ccggcaagaa catcggtgat ctgctcaacg ccaagggcat cacgtggggc       840
     ggcttcatgg gtggcttcaa cctggcgacg accaacagca acggtacaac cggctgtaaa       900
     cgcagtacag tcacaccggc ggttggtcag ccgacggccg attacatccc gcaccacaac       960
     tggttccagt actacgcgtc gacggcaaac ccgcaacatt tgcgtcccag cgcgacagca      1020
     gccatcgggt acaccctcca gtcggacggc aagactgtcg atccggccaa tcaccaatac      1080
     gattctgacg atttcttcgc agcggtgaag gccggaaact atccatccgt cagcttcatc      1140
     aaggcacctg ccttccagga cggtcacgct ggctactccg acccgctcga cgagcaggcg      1200
     ttcactgcga aagtcgtcaa cttcctgcag cagcagcctg actggaagag caccgcggtt      1260
     atcgtcgcgt gggacgattc ggacggctgg tacgaccatg cctatgcgaa tcccacaagc      1320
     tcgtcgttcg acgctcaggc ggaccagttg aacggcgctg gcaagtgcgg tacgggaacc      1380
     gctccgaacg gcgtaaacgg tgcggcagtc aatggtcgct gcggcccggg cacgcgtatc      1440
     ccgttcctcg tgatttcgcc gtgggcaaag gtcaactatg ttgatcacac gccgattagc      1500
     caggcatccg tggttcgctt catcgaagac aactggctgg gcagccaacg catcggcggc      1560
     ggctccttcg acgctacggc gggcagcatc atgggcctgt tcaacttcag cggctcgggc      1620
     aacaacccga cggtgttcgt cgatccgaac ctgggctcgg tagtctcttc cgtacctgcc      1680
     atctaa                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page