(data stored in ACNUC7421 zone)

EMBL: CP001053.PE27

CP001053.PE27        Location/Qualifiers
FT   CDS_pept        complement(29413..29763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4016"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bxe:Bxe_B0483 response regulator receiver domain
FT                   protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4016"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18402"
FT                   /db_xref="GOA:B2TE81"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE81"
FT                   /protein_id="ACD18402.1"
FT                   /translation="MKTILVVDDEFDILTVWRLLLERHGYTVLTASNGAAALEQIRNTR
FT                   PDIIVSDCMMPVMSGLQLCAELNADSDLRAIPIILCSAAADIPVQPNPRIEYARKPLSF
FT                   DALLTMLQRMGA"
     atgaaaacca ttctggtcgt ggacgatgag ttcgacatcc tgacagtctg gcggctgctg        60
     ctggagcggc acggctatac cgtgctgacg gcgtcgaacg gggccgccgc gctcgaacag       120
     atacgcaata cccggcccga catcatcgtg tcggactgca tgatgccggt catgtcgggg       180
     ctgcaattgt gcgcggagct gaatgccgat tcagatctgc gcgccattcc aatcatcctg       240
     tgcagcgcag ccgcggatat ccccgtgcag ccgaatcccc gcattgaata tgcgcgtaag       300
     ccgctttcat tcgatgcctt gctgaccatg cttcaacgta tgggcgcgta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page