(data stored in ACNUC7421 zone)

EMBL: CP001053.PE270

CP001053.PE270       Location/Qualifiers
FT   CDS_pept        317481..318581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4268"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18645"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX4"
FT                   /protein_id="ACD18645.1"
FT                   /translation="MTWQKMSFLRHVSFVILSFLSVQSSAKSGNNSDAIVSTEVVNPPQ
FT                   NIAFCHASTVAFSQGHLVAAWLAGSKEAANDVGVWVARFSGNQWSPPVRVADGRSPDGE
FT                   ALTVINPILFSPKRGPLMLFYRRGKLPADWHPLRMTSLDGGATWTKPVALDPGISGPAK
FT                   DKPVELSNGVVIAGSSTEYDGWKIHFERSMDGGNTWHVVYPAVGLPTVQAIQPTILDHR
FT                   HGQLQALVRTKSGFVFSTKSSDWGKTWSALARLDIPNSNSGLDAVTLTDGRDLIVTNPL
FT                   PYVEGRWDRHKLSVLISADHQTYRDVLDLENEAGQEFSYPAVIQSPDGMVHITYTWKKI
FT                   YIKHVVLDPKRIYASRSTLSAATGHQ"
     atgacgtggc aaaaaatgtc atttttgcga cacgtatctt tcgttatcct ttccttctta        60
     tccgtacaat cgtctgcaaa aagcggaaat aattctgatg cgatcgtatc cacggaagtc       120
     gtaaatcctc cgcagaacat tgcgttttgt catgcttcga cggtcgcatt ttcgcaaggc       180
     catttggtgg cggcatggct ggccggcagc aaagaagcgg cgaacgacgt tggtgtctgg       240
     gtggcgcgct tctctggcaa tcaatggagc ccgcctgtgc gcgtcgcaga cggtcgctcg       300
     cctgacggtg aagcgctgac ggtaattaac cccattctct tttcgcccaa acgcggtcct       360
     ttgatgttgt tctacaggcg agggaaactg ccagctgatt ggcatcctct gcggatgacc       420
     tcgcttgacg gcggcgccac atggacgaaa cccgttgctc ttgacccagg tatctctggg       480
     ccggcgaaag acaagcccgt cgagttatca aatggagtcg tgatagcagg aagcagcacc       540
     gagtatgacg gatggaaaat ccacttcgag cgttccatgg atggcggcaa tacgtggcat       600
     gtcgtgtacc cggcggtcgg gctacctacg gttcaagcga tccagcccac aattcttgac       660
     catcgtcacg ggcagttgca ggcgctagtt cgaacgaaaa gcggctttgt attcagcacc       720
     aagtcgagcg attgggggaa gacgtggagt gctctcgcgc ggttagatat tcctaactca       780
     aattctggtc tggacgcggt gaccttgact gacggccgcg acctgatcgt cacgaatcct       840
     ctgccttacg tcgaaggtcg ttgggaccga cacaagctgt ctgtcttgat ctcggcagac       900
     catcagactt atcgcgacgt gttggacctt gagaacgagg cgggtcagga gttttcgtat       960
     cccgcagtaa ttcagtcccc ggacgggatg gttcacatta cctacacatg gaaaaagatt      1020
     tatatcaagc atgtcgtgct tgatccgaag cgaatctacg cgtcccgttc aacgctgtca      1080
     gccgcgaccg gccatcaata g                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page