(data stored in ACNUC7421 zone)

EMBL: CP001053.PE271

CP001053.PE271       Location/Qualifiers
FT   CDS_pept        318663..319337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4269"
FT                   /product="ABC-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: mag:amb1293 ABC-type uncharacterized transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4269"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18646"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX5"
FT                   /protein_id="ACD18646.1"
FT                   /translation="MARFDDRSCSQQIFMINSVVDLLRKRVLVLQHAAAAACCMLVAAP
FT                   LAAHPHVWITYASVAQMHGSTLNAVQEKWTFSQGFPVSIVGDLADMPKAGSLGPRYVNI
FT                   FKQQAFDSLKGADYFTHVFVDGKPVRFGEPRNFAVSIDDGRIVYTFELPLADKVDVRLA
FT                   QVQLGIWDETFFVDFQPPPKGALPVVFDAAAPKTCTAQPLEDKAHPIFGGTIYPLSVKL
FT                   AC"
     atggcccgtt tcgatgaccg ttcgtgttcc caacagattt tcatgatcaa tagcgttgtc        60
     gacttgctcc gcaagcgcgt tcttgttttg cagcacgctg cagccgcagc gtgctgcatg       120
     ctcgttgcag ccccgctcgc cgctcacccc catgtgtgga tcacgtatgc gagcgtcgcg       180
     caaatgcacg gctcgacgct caacgctgtg caagagaagt ggaccttttc gcaagggttc       240
     ccggtgtcga tagtgggcga cctggctgac atgccaaaag ccgggtcgct tggacccagg       300
     tacgtcaata tcttcaagca gcaggctttc gattcactga agggcgcgga ttacttcacc       360
     catgtcttcg tcgacggcaa gccggtgcgc ttcggcgagc cgcgcaattt cgccgtctcc       420
     atcgacgatg gccgaattgt ctatacgttc gaactgccac tcgcggataa agtggacgtg       480
     cggctcgctc aggtgcaact ggggatatgg gacgaaacgt tctttgtcga ttttcagcca       540
     ccgccaaagg gcgccttgcc tgttgtattc gacgcagccg ctccgaagac ctgtaccgcg       600
     caaccgctcg aggataaagc tcacccgata ttcggcggta ctatttatcc gctctcggtg       660
     aagctcgcat gctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page