(data stored in ACNUC7421 zone)

EMBL: CP001053.PE276

CP001053.PE276       Location/Qualifiers
FT   CDS_pept        323839..324528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4274"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: atu:Atu4191 transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4274"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18651"
FT                   /db_xref="GOA:B2TEY0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY0"
FT                   /protein_id="ACD18651.1"
FT                   /translation="MNERKTTGLPDKIYGDILNRIVEGEYKEGERLPTEHALAERFATS
FT                   RPTVREALARLRADGIIMTRHGSGTTVARRPDPDVRRFAPLETLSDIRRCYEFRIVTEA
FT                   GAAEQAALKADADDIAAIQHAWDQLERIIETQGIGAKDDFMFHLAVARASKNPFFITVM
FT                   SFIEEQILFSMNLSRNLSLVKTVARQRLVQEEHRAVLDAIRRKDAPGAASAMRAHLENA
FT                   LERMFGS"
     atgaacgagc gcaaaacgac gggcttgccc gacaagatct acggcgacat tctcaatcgc        60
     attgtcgaag gcgagtacaa ggaaggtgag cgcttgccga ccgagcatgc gctggccgag       120
     cgtttcgcga cgtccaggcc gacggtgcgc gaagccttgg cgcgcttgcg ggcggacggc       180
     atcatcatga cccggcacgg ctcgggcacg acggtcgcgc gccggccgga cccggacgtg       240
     cgccgcttcg cgccgctcga aacgctgtcc gatatccgtc gctgctatga gtttcgcatc       300
     gtgacggaag cgggcgccgc ggagcaggcg gcgctcaaag ccgacgccga cgacatcgcc       360
     gccatccagc acgcatggga ccaactggag cggatcatcg agacgcaagg gatcggcgcg       420
     aaagacgact ttatgttcca cctggcggtg gcgcgtgcgt cgaagaaccc ttttttcatc       480
     acggtcatgt cgttcatcga ggagcagatc ctgttcagca tgaacctatc gcgcaatctt       540
     tcgctggtga agacggtggc gcggcagcgg ctcgttcagg aggagcatcg ggctgtgctc       600
     gatgcgatcc gccgcaagga tgcgccaggc gcggcgagcg ccatgcgagc gcatcttgag       660
     aacgcgctcg agcggatgtt cggttcctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page