(data stored in ACNUC7421 zone)

EMBL: CP001053.PE278

CP001053.PE278       Location/Qualifiers
FT   CDS_pept        325453..325770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4276"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18653"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY2"
FT                   /protein_id="ACD18653.1"
FT                   /translation="MELIENHWQPQTGVQTRPAEPSTAVDRVLIIAYRKKKKESQRRFW
FT                   ARFGVTQSRGSRFESGAEIPPPVSILLGLYFTKTVSDADLGRAERVLYSRDAAALLNPG
FT                   Q"
     atggaactca tcgaaaatca ttggcaaccg caaaccggcg ttcagacccg tccggcggag        60
     ccttccacgg cggtggaccg cgttctgatc attgcttacc gcaagaagaa aaaagaaagc       120
     caacgccgtt tctgggcgcg cttcggcgtg acgcagtcgc gcggcagccg gttcgaatcc       180
     ggtgcggaaa tcccgccgcc ggtctcgatc ctgctgggtc tgtacttcac caaaaccgtg       240
     tccgacgccg atctgggccg cgccgagcgc gtgctgtaca gccgcgacgc cgccgccttg       300
     ctcaacccgg gtcaataa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page