(data stored in ACNUC7421 zone)

EMBL: CP001053.PE28

CP001053.PE28        Location/Qualifiers
FT   CDS_pept        complement(29770..31245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4017"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="PFAM: KaiA binding; KEGG: bxe:Bxe_B0484 RAD55"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4017"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18403"
FT                   /db_xref="GOA:B2TE82"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE82"
FT                   /protein_id="ACD18403.1"
FT                   /translation="MTNHESQTSSRSNVETGVPGLDEILGGGLVRGGVYLLEGMAGAGK
FT                   TILSSQIGFHRVSQGEKVLYMTLIAESHDKLLGHLKGLSFFDEKAVAQQMLFVSGYHEL
FT                   MKDGLDGFLKLIASSIYDYRPSLMIIDGFRSAREFSETELSLSKFIHELNALVAAMDCT
FT                   TLLLAPLSGNEPHPEHTLVDGLIELNRYSDGMRRAREIEVHKMRARNHLMGKHFFRIAE
FT                   SGLLMFPRLEAQCAAQAGPVDLKTRLGFALPHLDGLLGGGFAQGSTTTLVGPSGVGKTL
FT                   LCLQFLAAGVARGERCLYLGFYEGPQRLIGKAEAVSIGLANAYQDGRLVIQWQPAIELA
FT                   VDELAATALATVKKIGASRIVIDGVEGFRDSALRTERFGLFLNALLHQLREACITTLLT
FT                   EELPLYADPGHARSVRVSALTENLVLLRYAETDTGLRRMISVVKQRESAHDTSLRELVI
FT                   SSQGLDVIENPASAASLHAPAGLSATLQPRRNT"
     atgactaacc acgaatctca gacgtcttcc cgatccaacg tggaaacggg tgtccccggt        60
     ctcgacgaga tcctgggcgg aggtttggtc cgcggcggcg tgtatctgct ggagggcatg       120
     gccggcgccg gcaagacgat cctgtcgagc cagattggtt ttcatcgtgt aagccagggc       180
     gagaaggtgt tgtacatgac cttgatcgcc gaatcgcacg acaagctgct aggccatctc       240
     aagggtctga gtttcttcga tgagaaggcg gtcgcccagc agatgctgtt cgtgtccggc       300
     tatcacgagc tgatgaagga cggcctggat ggcttcctca agctgattgc ctcgagcatt       360
     tacgattacc gtccgagcct gatgatcatc gacggctttc ggagcgcgcg tgaattcagc       420
     gagaccgagc tgtcgctgtc caagttcatc cacgagttga atgcgctggt cgcggccatg       480
     gattgcacga ccttgctgct cgcgccgctg tccggcaacg aaccgcatcc ggaacatacg       540
     ctcgtcgacg gcctgatcga actgaaccgc tacagcgacg gcatgcgccg cgcgcgcgaa       600
     atcgaagtcc acaagatgcg cgcgcgcaat catctgatgg gcaagcattt cttccgcatc       660
     gccgaaagcg ggctcttgat gttcccgcgc ctcgaggcgc aatgtgccgc gcaagccggt       720
     ccagtggatc tgaaaacgcg gctcggcttc gccctgccgc atctggacgg cctgctgggc       780
     ggcggctttg cgcaaggctc cacgactacg ctggtcgggc cgtcgggcgt cggcaagact       840
     ctcctgtgtc tgcagtttct cgcggccggc gtcgcgcgcg gcgaacgctg cctgtacctc       900
     ggcttttacg aaggaccgca acgtctgatc ggcaaagccg aggccgtgtc gatcggactc       960
     gcaaacgcgt atcaggacgg ccggctcgtg attcaatggc aaccggccat cgaactggcc      1020
     gtcgacgagc tggcggccac cgcgctcgcc acggtcaaga agatcggcgc gtcgcgcatt      1080
     gtcatcgacg gcgtggaagg gtttcgcgat tccgcgttgc gtaccgaacg cttcggcttg      1140
     ttcctgaatg cgctgctgca ccagcttcgc gaagcctgca tcaccacgtt gctgaccgaa      1200
     gagctgccgc tttacgccga tccgggccac gcgcggagcg tgcgcgtttc ggcgctgacg      1260
     gaaaacctgg tgctgctgcg ttacgccgaa acggacacgg gtctgcggcg catgatttcc      1320
     gtggtcaagc agcgtgaaag cgcccacgac acttccttgc gcgagctcgt gatttcgtct      1380
     caaggcctcg atgtcatcga aaatccggcg agtgctgcca gcctgcatgc gccggccggc      1440
     ctgtcggcca cacttcagcc gcgacgaaat acctag                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page