(data stored in ACNUC7421 zone)

EMBL: CP001053.PE280

CP001053.PE280       Location/Qualifiers
FT   CDS_pept        327147..328088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4278"
FT                   /product="Gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: bxe:Bxe_B0611 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4278"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18655"
FT                   /db_xref="GOA:B2TEY4"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY4"
FT                   /protein_id="ACD18655.1"
FT                   /translation="MTDNTRRYPDPSIRVFDPRFKPLILASASVECLYQGARWSEGPVW
FT                   FGDGRYLLWSDIPNDRILRWDEPSGTVSTFRQSSNNANGHTRDRQGRLVSCEHLTRRVT
FT                   RTEYDGSITVLAERYRGKRFNSPNDVVVKSDGSIWFSDPTFGIDGFYEGERQESELPAC
FT                   VYRIDGQSGEVTVVADDVLGPNGLAFSPDESVLYIVESRGEPHRTIRAFDVEGTGGALS
FT                   NNRVLIDAGPGTPDGFRVDVHGNLWCGWGMGTDELDGVRVFTSQGEPLGHIALPERCAN
FT                   VCFGGRHRNRLFMAASHGLYSLYVNTQGVQGG"
     atgaccgaca acactcgacg ctatcccgac ccatccatcc gcgtgttcga cccgcgcttc        60
     aaaccgttga tcctggcttc cgcgtccgtc gagtgcctgt accaaggcgc gcgctggtcc       120
     gagggcccgg tctggttcgg cgacggccgc tatctgctat ggagcgacat tccgaacgac       180
     cgcatcttgc gctgggacga accaagcggc acggtgtcga cgtttcgtca gtcgtcgaac       240
     aatgccaacg gccatacacg cgaccgtcaa ggccgtctcg tcagctgcga gcatctgacg       300
     cgccgcgtca cgcgcaccga atacgacggc tcgatcaccg tgctcgccga gcgctatcgc       360
     ggcaagcgct tcaattcgcc gaacgacgtg gtcgtgaaat ccgacggctc gatctggttc       420
     agcgatccga ccttcggcat cgacggcttc tatgagggcg agcgccagga gtcggaattg       480
     ccggcgtgcg tgtaccgcat cgacggccaa tccggcgaag tcaccgtcgt cgcggacgac       540
     gtgctcggcc ccaacggtct ggcgttctca ccggacgagt cggtgctgta catcgtcgaa       600
     tcgcgcggcg agccgcaccg cacgatccgt gcattcgacg tcgaaggcac cggcggcgcg       660
     ctgtcgaaca accgcgtcct gatcgacgcg ggtccgggca cgccggacgg ctttcgcgtc       720
     gacgtccacg gcaatctgtg gtgcggctgg ggcatgggca ccgacgaact cgacggcgtg       780
     cgcgtcttta cctcgcaagg cgagccgctc ggccacattg ctctaccgga gcgctgcgcg       840
     aacgtgtgct ttggcgggcg gcatcgcaac cggctgttca tggcggcaag ccacggactt       900
     tattcgctct atgtgaacac ccaaggcgtg caaggcggct ag                          942
//

If you have problems or comments...

PBIL Back to PBIL home page