(data stored in ACNUC7421 zone)

EMBL: CP001053.PE282

CP001053.PE282       Location/Qualifiers
FT   CDS_pept        329586..330665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4280"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_A4846 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4280"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18657"
FT                   /db_xref="GOA:B2TEY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY6"
FT                   /protein_id="ACD18657.1"
FT                   /translation="MKHHFEQLRLDSVSRSFTNAEGQAIAALRGLDLTIQRGEFIALLG
FT                   PSGCGKSTALNCIAGLQPLTSGGIWLDDKRIDVLPPEKRGFGMVFQNYALFPHMSVLDN
FT                   VGFGLKMRGIGKSEAVRRVREALQLVQLVGHERKLPGQLSGGQQQRVAIARAIVIEPPL
FT                   ILMDEPLSNLDTKLRIEMRAEIRRIHSQLERATLYVTHDQDEALSMADRIVVMREGVVQ
FT                   QVATPKEVYTRPQNLHVARFMGYRNVAEFELEGMQGESVMVSAHGVRLLGTPMAGFNSK
FT                   RVSVALRPEDMERATPGAENAFDALVTTVEYGGRDSLLRVKTAFGDIWARVGGEFEEGE
FT                   RISLRVPPSRTLVYDAEAV"
     atgaagcatc actttgagca gttgcggctc gattcggtga gccgcagttt cacgaatgcg        60
     gaaggccagg cgatcgcggc actgcgtgga ctcgatctga ccatccagcg tggcgagttc       120
     atcgcattgc tggggccgtc cggttgcggc aagtcgacgg cgctcaattg catcgccgga       180
     ttgcagccgt tgacgagcgg cggcatctgg ctcgacgaca aacgcatcga cgtactgccg       240
     ccggagaagc gcggcttcgg catggtattt cagaactacg cgctgtttcc gcacatgagc       300
     gtgctcgaca acgtcggctt cggtttgaaa atgcgcggca tcggcaagag cgaagccgtg       360
     cgccgggtgc gcgaagcgtt gcaactcgtg caactagtcg ggcacgagcg caaactgccc       420
     ggccaactct ccggcggcca gcagcaacgc gtcgcgattg cgcgcgcgat cgtgatcgag       480
     ccgccgctga tcctgatgga cgaaccgctg tcgaatctcg acaccaagct gcgcatcgaa       540
     atgcgcgcgg agattcgccg catccatagc cagctcgaac gcgcgacact ttacgtgacg       600
     cacgatcagg acgaagcgct gtccatggcc gatcgcatcg tcgtgatgag ggaaggcgtg       660
     gtgcagcagg tcgccacgcc gaaagaggtc tatacgcggc cgcagaatct gcatgtcgcg       720
     cgcttcatgg gctatcgcaa tgtggccgag ttcgaactcg aaggcatgca aggcgaaagc       780
     gtgatggtga gcgcgcacgg tgtgcgtctg ctcggcacgc cgatggccgg cttcaatagc       840
     aaacgcgtga gcgtcgcgct gcgtcccgag gatatggagc gcgccacgcc cggtgcggag       900
     aatgccttcg atgcgttggt gacgaccgtc gaatacggcg gccgcgattc gctgctgcgc       960
     gtgaagaccg cctttggcga tatctgggcg cgcgtcggcg gagaattcga agaaggcgag      1020
     cgcatcagcc tgcgcgtgcc gccgtcgcgc acgctcgtgt acgacgcgga ggcggtgtga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page