(data stored in ACNUC7421 zone)

EMBL: CP001053.PE287

CP001053.PE287       Location/Qualifiers
FT   CDS_pept        complement(335224..335679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4285"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18662"
FT                   /db_xref="InterPro:IPR021551"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ1"
FT                   /protein_id="ACD18662.1"
FT                   /translation="MMNSDIKKPADATQPAATSRANTAELHNDRTHDSTVDTDGKNLEA
FT                   ARIAGHSPISPDEITTSNATLTNSVPESLDGMAGFDSRVGGNHLLLALEPGYTVIDKGM
FT                   VAPQGAYSADHQYDDPRPVGSRQDRGRIHYALNHLRPTRLIELHRVK"
     atgatgaaca gcgatatcaa gaagccagca gacgcaacgc aaccggctgc caccagccgc        60
     gcgaacaccg cggaattgca caacgaccgc acccacgaca gcaccgtcga caccgacggc       120
     aaaaacctcg aagccgcgcg catagcgggc cacagcccca tctcgcccga cgagatcacc       180
     accagcaatg caaccctcac gaacagcgtg cccgagtcgc tcgacggcat ggccggcttc       240
     gacagccggg ttggcggcaa tcatctgctg ctcgcgctcg aaccgggcta caccgtgatc       300
     gacaaaggca tggtcgcgcc gcaaggtgcg tattcggcgg accatcagta cgacgatcca       360
     cggccggtcg gcagccgtca ggaccgcggc cgcattcatt acgcccttaa tcatttgcgc       420
     cctaccaggc tgatcgaatt acatcgggtg aaataa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page