(data stored in ACNUC7421 zone)

EMBL: CP001053.PE292

CP001053.PE292       Location/Qualifiers
FT   CDS_pept        complement(338952..339422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4290"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18667"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ6"
FT                   /protein_id="ACD18667.1"
FT                   /translation="MSLRLNGGFVAKHDVALYRVALRPRPTFPRTTGDADDRTMKRLLL
FT                   LAPAAAALAALAGCGSSSGPARDASLPMIYVSSQHAPAYIADCLESRLSRVRTSHVGSA
FT                   TEIAVGSDSNNSYFVTLTPSNAGSVIKVMHPANAPDDPPEPEMRFDIARCAT"
     atgtcgttgc ggttgaacgg cggcttcgtc gcgaagcatg acgtcgcgct ctatcgcgtt        60
     gcgcttcgcc cgcgccccac gttcccgcgt acgaccgggg acgccgacga ccggaccatg       120
     aaaagacttc tcctgcttgc tcccgctgcc gccgcgctcg ccgccctcgc cggctgcggc       180
     tcttccagcg gccccgcccg cgacgcgtcc ctgccgatga tatacgtgtc ctcgcaacac       240
     gcccccgcct atatcgccga ttgcctcgaa agccgtttgt cacgtgtgcg tacgtcgcac       300
     gtcggcagcg cgacggagat cgccgtcggc tccgattcga acaactcgta tttcgtgacg       360
     ctgacgccgt cgaacgccgg ctccgtcatc aaggtcatgc atcccgccaa cgcgccggac       420
     gatccgccgg aaccggaaat gcgcttcgat attgcacgct gcgcgacctg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page