(data stored in ACNUC7421 zone)

EMBL: CP001053.PE296

CP001053.PE296       Location/Qualifiers
FT   CDS_pept        344204..344794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XACb0003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4294"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18671"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF00"
FT                   /protein_id="ACD18671.1"
FT                   /translation="MQWISILRQGYIDVASVRYGLSHLVASFFTLAIPASGKFAATTAT
FT                   VHVEYTSHCVSVGPGAQSPLDFEAPGSGRRIFDRRQVARAFCAERYRWSLRLPAIVAQL
FT                   GERRCYFTGHSNWLVIEDITDRGQPVEYEVFFRLRRMGASALRLVIESAYVRDVTRGKA
FT                   GTPRNRRSIVRFRVMAAKILRGKSIRDPSLNRR"
     atgcagtgga tttcgatttt gcgacaaggt tatatcgacg tggcaagcgt gcgatatggc        60
     ctttcgcatc tcgtcgccag cttctttact ctcgccattc ccgcttcggg taagtttgct       120
     gcgacaacgg cgaccgtgca tgtcgaatat acgtcgcatt gtgtgtcggt cgggccgggc       180
     gcccaaagcc cgttggattt cgaagcgcct ggtagtggcc gcaggatctt tgaccgtcgg       240
     caggtggctc gcgcattctg cgccgaacgg taccgctggt cccttcgact gccagcgatc       300
     gtcgctcagc tcggcgaacg gcgttgttat ttcacgggtc attcgaactg gctcgtgatc       360
     gaggacatca cggatcgcgg ccagccagtt gagtacgagg tgttttttcg tcttcgccgc       420
     atgggggcga gcgcattgcg gctcgtgatc gaaagcgcct atgtgcgcga cgtgaccagg       480
     ggcaaggcgg ggactccgcg caaccggcgc agcatcgtgc ggtttcgtgt gatggcggca       540
     aagatactga ggggcaagtc gattcgcgat ccgagtctca accgccgtta g                591
//

If you have problems or comments...

PBIL Back to PBIL home page