(data stored in ACNUC7421 zone)

EMBL: CP001053.PE297

CP001053.PE297       Location/Qualifiers
FT   CDS_pept        complement(345059..345493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_5556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4295"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18672"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF01"
FT                   /protein_id="ACD18672.1"
FT                   /translation="MKRFLSSVLLALAAAALPLASYATALDVPLACNESGHQFIADLAD
FT                   QQLIDPKPTRVESNSINAFSPTSGANLTAYGFRVFAVVGYEKDDPMFRVGDGEPVARSA
FT                   YGVVVFGSEAKVRNAIAGTGSTAIVHRVAPLITAIFCKRS"
     atgaaacgct ttctttcgtc tgtactcctt gctctggcag ccgccgcgtt gccgcttgcc        60
     agttacgcca ccgcgctcga cgtgccgctc gcctgcaatg aaagcggcca tcagttcatt       120
     gccgacctcg cggaccaaca gctgatcgac ccgaagccca cgcgtgtgga aagcaactcg       180
     atcaacgcct tctcgccgac ctccggcgcg aatctgacgg catacggctt tcgggtgttc       240
     gcggtggtcg gctacgaaaa agacgacccc atgttccgtg tcggcgacgg cgagccggtc       300
     gcgcgttcgg cctacggcgt cgtggtgttc ggtagcgagg ccaaagtgcg gaacgcgatt       360
     gccggcaccg gcagcacggc gatcgtgcac cgcgtggcgc cgctgattac ggcgattttt       420
     tgcaagcgga gttga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page