(data stored in ACNUC7421 zone)

EMBL: CP001053.PE298

CP001053.PE298       Location/Qualifiers
FT   CDS_pept        345740..346441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4296"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   bxe:Bxe_B0624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4296"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18673"
FT                   /db_xref="GOA:B2TF02"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF02"
FT                   /protein_id="ACD18673.1"
FT                   /translation="MNSRPQTPINVPPPRTWDARLARRLVTPLVNTWVTPNHLTTLRLL
FT                   IGLAGALCLAHGEFAWANAGALLIVLSNFVDHTDGELARIGGKSSRIGHFYDLACDALV
FT                   TVMLFVGMGVGAGATHIAGLKIAPGVLGAVAGVAIALIFFLRMRIEEMAGKAGTRQASV
FT                   GGFETEDVLYLLPIVTLTSVVLPFVVVASIGAPLFAVWVVVDYWRVARRAASAPPVAAG
FT                   TAETRQMWASE"
     atgaattcgc gaccccagac tccaattaac gttccgccgc ccagaacatg ggacgcgcgg        60
     ctcgcccgcc ggctcgtgac tccgctcgtg aacacgtggg tcaccccgaa ccacctgacc       120
     acgctgcgcc tcctgatcgg gctggcaggc gcgctgtgcc tggctcacgg cgaattcgcc       180
     tgggctaacg ccggcgccct cctgatcgtg ctgtcgaact tcgtcgacca tacggacggt       240
     gaactcgcgc gcatcggcgg aaagtcgagt cggatcggtc atttttacga cctcgcttgc       300
     gacgccctcg tgaccgtcat gttgttcgtc ggcatgggcg tgggagctgg cgccacgcac       360
     atcgccggct tgaagatcgc gccaggtgtg cttggcgccg tggccggcgt ggcgatcgcg       420
     ctgattttct tcctgcgcat gcgcatcgag gaaatggccg gcaaggcggg cacgaggcag       480
     gcatcagtcg gcggtttcga aacggaagac gtcttgtacc tgctaccgat cgtcacgctg       540
     acaagcgtcg ttctgccctt cgtggtggtc gcgtcgatcg gcgcgccgct cttcgctgtc       600
     tgggtggtgg tcgactactg gcgcgttgcg cgtcgtgccg ccagcgcgcc gccggttgcc       660
     gccggcacgg ccgaaacccg tcagatgtgg gccagcgaat ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page