(data stored in ACNUC7421 zone)

EMBL: CP001053.PE301

CP001053.PE301       Location/Qualifiers
FT   CDS_pept        348294..349058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4299"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18676"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF05"
FT                   /protein_id="ACD18676.1"
FT                   /translation="MRAIILAAGLGLRLQQPPEAQFPKCLLQFDGMSLLERHLQMLETA
FT                   GVTEVVLALGFQPESVQAELERINWPHQVETVLNTRYDLGSVLTVHTVADALTRGGDVL
FT                   LMDADVLYDERILAALVAGETVNRLLIDRDFEAGDEPVKLCLKDGVPVELRKQLAVNLE
FT                   YDTIGESVGFFRFRQETAQRFAQIVAGYVDSGRANLPHEEAVRDLLLERSQVFDTADVT
FT                   GAPWIEIDFPNDVARASTEILPQLQPLVSASR"
     atgcgtgcca tcattctcgc tgcgggcctc ggcctgcgtc tccagcaacc gccggaagct        60
     cagttcccga agtgtctgtt gcaattcgac ggcatgagcc tgctcgaacg gcatctgcaa       120
     atgctcgaaa ccgccggcgt gacggaagtc gtgctggcgc tcggctttca gccggaatcg       180
     gtgcaggcgg aactggagcg catcaactgg ccgcatcagg tggaaacggt gttgaacacg       240
     cgttacgacc tgggcagcgt gctgacggtg cacacggtgg ccgatgcgtt gacgcgcggc       300
     ggcgacgtgc tgctgatgga cgccgacgtg ctctacgacg agcgcattct ggctgctttg       360
     gtggcgggcg agacggtcaa ccgcctgttg atcgaccgtg atttcgaagc cggcgacgaa       420
     cccgtcaagc tgtgtctgaa agacggcgtg ccggtcgagt tgcgcaagca gctcgcggtc       480
     aatctcgagt acgacaccat cggcgagtcg gtcgggttct tccgcttccg ccaggagacc       540
     gcgcaacgct ttgcgcagat cgtggccggc tatgtggaca gcggccgcgc caacctgccg       600
     cacgaagaag cggtgcgcga tctgctgctg gaacgtagcc aggtgttcga taccgccgac       660
     gtgaccggtg caccgtggat cgagatcgac ttcccgaacg acgtggctcg cgcaagcacc       720
     gagattctgc cgcagttgca gccgctggtc agcgcatcgc gctaa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page