(data stored in ACNUC7421 zone)

EMBL: CP001053.PE304

CP001053.PE304       Location/Qualifiers
FT   CDS_pept        complement(352770..353813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4302"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: bxe:Bxe_B0630 putative
FT                   serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4302"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18679"
FT                   /db_xref="GOA:B2TF08"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF08"
FT                   /protein_id="ACD18679.1"
FT                   /translation="MGSRPRFVDDLSRAASDAPGPETLNPFSDDALLDAYSRTVIGALE
FT                   RVQQAVAFIAVERRLPGQPSGRGRGSRGGTGSGFLFTPDGYLLTNSHVVHGATHITVTL
FT                   ADGAKFDADLVGDDPGSDLAVLRIGSPEPLAHVELGESSKLRVGQIAIAVGNPLGLAQT
FT                   VTTGVVSALGRSLRSNSGRMIYDVIQTDAALNPGNSGGPLINSAGQVIGVNTAIIPGAQ
FT                   AICFATAIDTAKWVIMQIFAHGRVRRAYIGVAGTTRPLSRRVQRYFGLSSESGVHVMEI
FT                   VKGSPAALGGLRTDDTIIAIDTQAVQDVDSLQRTLDASRIDRPVNVTVLRGAQRLELTL
FT                   TPVEQAS"
     atgggaagcc gcccacgctt cgtcgatgac ctgtcgcgcg ccgcatccga cgcccccggg        60
     cccgagacac tcaatccttt ttccgacgac gccctgctcg acgcctactc ccgcaccgta       120
     atcggcgcgc tggaacgcgt tcagcaagca gtcgccttca ttgccgtcga acggcgcctg       180
     cccggccagc cgtccggccg cggacgcggt tcgcgcggcg gcaccggctc gggctttctg       240
     tttacgcccg acggctatct gctcaccaat agtcacgtcg tgcacggcgc cacccacatt       300
     accgtgacgc tcgccgacgg cgcgaaattc gacgccgatc tggtcggcga cgatcccggc       360
     agcgatctgg ccgtcctgcg gatcggctca ccggagccgc tggctcatgt cgaactcggc       420
     gaatcgtcga aactgcgtgt cggtcaaatt gcgattgcgg tcggcaatcc gctcggcctc       480
     gcgcaaacgg tcacgaccgg tgtagtgtcg gcgctcggcc gctcgttgcg ttcgaattcg       540
     ggccgcatga tctacgacgt gatccagacc gatgccgcgc tcaatcccgg caattcgggt       600
     ggtccgctaa tcaattcggc gggccaggtg atcggcgtga ataccgcgat cattcccggc       660
     gcacaggcca tctgctttgc caccgcaatc gacaccgcca agtgggtcat catgcagatc       720
     ttcgcgcatg gccgcgtgcg gcgcgcttat atcggcgtcg cgggcacgac caggccgctg       780
     tcgcgccgtg tgcagcgtta tttcggcttg agctcggaaa gcggcgtaca tgtcatggag       840
     atcgtcaaag gcagcccggc cgcgctcggc ggtctgcgca ccgacgatac gatcatcgcg       900
     atcgatacgc aggccgtgca ggacgtggac agtttgcagc gcacgctcga cgcatctcga       960
     atcgacagac cggtcaatgt gacggtgttg cgcggcgcgc agcggctcga attgacgttg      1020
     acgccggtcg agcaggctag ctga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page