(data stored in ACNUC7421 zone)

EMBL: CP001053.PE305

CP001053.PE305       Location/Qualifiers
FT   CDS_pept        354105..354503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4303"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_B0631 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4303"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18680"
FT                   /db_xref="GOA:B2TF09"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF09"
FT                   /protein_id="ACD18680.1"
FT                   /translation="MNPAATSPSSSGPTEPQIESISAITLATRDMPRAVLFYEALGFPM
FT                   KFGGPQEAFTSFAFGGSYLNLIVDTRAPVAWWGRVIIYVSDVDALYRKALAAGLKPSLE
FT                   PSDAPWGERYFHITDPDGHELSFAKPLR"
     atgaacccag ccgccacatc accttcgtcg agcgggccga cggaacccca aatcgaatcg        60
     atcagcgcca ttacgcttgc cacccgcgac atgccacgcg ccgtgctgtt ttacgaagca       120
     ctcggctttc cgatgaaatt cggcggtccg caggaggctt tcacatcgtt tgcgttcggc       180
     ggttcgtacc tgaatctgat cgtcgatacg cgcgcgccgg tcgcctggtg gggccgcgtg       240
     atcatctatg tctccgacgt cgacgcgctt tatcgcaaag cgctggcggc gggactaaaa       300
     ccgtcgctgg aaccgtccga tgcgccttgg ggcgagcgct attttcacat caccgatccg       360
     gacggccacg aactcagctt cgcgaaaccg ttgcgctag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page