(data stored in ACNUC7421 zone)

EMBL: CP001053.PE306

CP001053.PE306       Location/Qualifiers
FT   CDS_pept        354660..355586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4304"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   bxe:Bxe_B0632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4304"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18681"
FT                   /db_xref="GOA:B2TF10"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF10"
FT                   /protein_id="ACD18681.1"
FT                   /translation="MKEQDPRPEAELMAERQRRFEEDLIDAYDEELEMEVDDRIIDGAE
FT                   GFTPEHREARKMYFRELFRLQGELVKLQDWIVQTGHRLVVIFEGRDAAGKGGAIKRITQ
FT                   RLNPRVCRVAALPAPNNRERTQWYFQRYVSHLPAGGEMVLFDRSWYNRAGVERVMNFCS
FT                   DEEYEEFFRSVPEFEKMLARSGVQILKYWFSITDEEQEIRFQNRIHDPLKQWKLSPMDL
FT                   ESRRRWEAYTQAKEVMLQRSHILEAPWWVVQAVDKKRARLNCIHHLLSQVPYHEIEHSQ
FT                   IELPSRVYHDEYSRQPVPASMIVPEVY"
     atgaaagagc aggatccgag acccgaggct gaattaatgg cagagcggca gcgccgtttc        60
     gaagaggacc tgatcgacgc ctacgacgag gaactcgaaa tggaggtcga cgaccgcatc       120
     atcgacggcg cggagggctt cacgcccgag catcgcgagg cgcgcaagat gtacttccgc       180
     gagctgttcc ggttgcaggg tgaactcgtg aaactgcagg actggatcgt gcagaccggc       240
     catcgcctcg tggtgatttt cgaggggcgc gatgcggccg gcaagggcgg cgcgatcaaa       300
     cgcatcacgc aacgtctcaa tccacgggtg tgccgcgtgg cggcgctgcc ggcgccgaat       360
     aaccgcgaac gcacgcagtg gtactttcag cgctacgtgt cgcatctgcc ggccggcggc       420
     gaaatggtgc tgttcgatcg cagctggtac aaccgcgcgg gcgtcgagcg cgtgatgaat       480
     ttttgcagcg acgaagagta cgaagagttt ttccgttcgg tgccggaatt cgaaaagatg       540
     ctggcgcgca gcggcgtgca gattctcaag tactggtttt cgattaccga cgaagagcag       600
     gagatccgct ttcagaaccg cattcacgac ccgctgaagc agtggaaact gagtcccatg       660
     gaccttgaaa gccgacgtcg ctgggaagcc tatacgcagg ccaaggaagt gatgctgcag       720
     cgctcgcata ttctcgaagc gccgtggtgg gtcgtgcagg cggtcgacaa gaagcgcgcg       780
     cgcctgaact gcattcacca tttgttgagc caggtgccgt atcacgagat cgaacattcg       840
     cagatcgaat tgccctcgcg cgtttatcac gacgagtaca gccgtcagcc ggtgccggct       900
     tcgatgatcg tgcctgaggt gtactag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page