(data stored in ACNUC7421 zone)

EMBL: CP001053.PE308

CP001053.PE308       Location/Qualifiers
FT   CDS_pept        complement(357489..358082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4306"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: reu:Reut_C6188 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4306"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18683"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF12"
FT                   /protein_id="ACD18683.1"
FT                   /translation="MRILIVGATGLIGGEVVKLLAAEHDIVTASRKGSDLHVDLSNKGS
FT                   IESMYQQAGTLDAVICTAGAAKFAPLDSLSDDDFSFSLTNKLMGQVNLVRCGAAHVSQG
FT                   ACFTLTSGTLAQHPMEGSAAVSIVNAGVEAFARSAALELRGKARVNVVSPGWVAETLES
FT                   MGRDPSQGVPVAVVAQAYKRSLNGSASGDVISAS"
     atgcgaatac tgattgtcgg tgcaaccggt ctgatcggcg gcgaggtggt caagttgctc        60
     gccgccgaac acgatatcgt caccgcgagc cgcaagggtt cggatctcca cgtggatctg       120
     tcgaacaaag gcagcatcga atcgatgtac cagcaagccg gcacgctcga cgcggtcatc       180
     tgcaccgccg gcgcagcgaa gttcgccccg ctcgactcac tctccgacga cgatttctcg       240
     ttcagtctta ccaacaaatt gatgggccag gtcaatctgg tgcgctgcgg cgcggcacac       300
     gtgtcgcaag gcgcgtgctt cacgctgacg agcggcacgc tcgcacagca cccgatggaa       360
     ggcagcgcgg ccgtcagcat cgtgaatgcc ggcgtggaag cgttcgcgcg ctcggcggca       420
     ctcgagctgc gtggcaaagc ccgcgtcaac gtggtcagcc cgggctgggt cgccgagacg       480
     ctcgaatcga tgggccgcga tccgtcgcaa ggcgtgccgg ttgccgtggt ggcgcaggcc       540
     tacaagcgca gcctcaatgg cagcgcgagc ggcgacgtga tttccgcctc gtga             594
//

If you have problems or comments...

PBIL Back to PBIL home page