(data stored in ACNUC7421 zone)

EMBL: CP001053.PE309

CP001053.PE309       Location/Qualifiers
FT   CDS_pept        358349..359230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4307"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; KEGG:
FT                   bxe:Bxe_B0637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4307"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18684"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF13"
FT                   /protein_id="ACD18684.1"
FT                   /translation="MKRDNPKGEKRSADSEPAVKAHSAQEAFSSYAAPLVDHAIEYANA
FT                   VREDPSPEALHKLRVSLRRLRSLWWAFEPLLESGENTRQRALYKYLATAAGKTRDWDIL
FT                   IELLTRDDNGARSGTGEIAPKLQDARGAALTTSRETLSNADVKHLLREALSTASKELNT
FT                   AHERTPLRKFAEQRVAASERSLKKRMKRARRAKRSNYVAFHNVRKAGKKLRYLLEFFGP
FT                   ILSGGRKRTLKRLKQIQKRFGTLNDVVASEMLLRDNAALLAGAGDPEAALHWLGKERKR
FT                   RMRSAAGLLRKL"
     atgaagcgcg acaatccgaa aggcgaaaaa cgatccgccg acagcgaacc ggcggtcaag        60
     gcgcactccg cgcaagaggc tttctcgtcg tatgcggccc ctcttgtcga tcacgcgatc       120
     gaatacgcga acgcggtgcg cgaagacccg tcgccggaag cgctgcacaa attgcgcgtc       180
     tcgctacggc gcttgcgctc gttatggtgg gcgttcgagc cgttgcttga aagcggcgag       240
     aacacccggc aacgcgcgct atataagtat ctggccacgg ccgccggcaa aacgcgcgac       300
     tgggacattc tgatcgaact gctgacacgc gacgataacg gcgcgcgcag cggcaccggc       360
     gaaatagcgc ccaaactgca ggacgctcgc ggcgccgcgt tgacgacaag ccgcgaaacg       420
     ctctcgaacg ccgacgtcaa gcatctgctg cgcgaagctt tgtccactgc gtccaaagaa       480
     ctgaacaccg cgcatgaacg cacaccgctg cggaaattcg ccgagcaacg cgtggccgct       540
     tccgagcgtt cgctgaagaa gcggatgaaa cgcgcgcgcc gcgcgaagcg ctccaactac       600
     gtcgcctttc acaacgtcag gaaggcgggc aagaagctgc gctatctgct ggagtttttc       660
     ggaccgatcc tgagcggcgg ccgcaaacgc accctcaaac gtttgaagca gatccagaaa       720
     cgtttcggta cgctgaacga tgtggtcgca agcgagatgt tgctgcgcga caatgcggct       780
     ttgcttgcgg gcgcaggcga ccctgaagcg gcgcttcact ggctcggcaa ggagcgcaaa       840
     cgccggatgc gttcggcagc cggactgctg cgcaagctgt ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page