(data stored in ACNUC7421 zone)

EMBL: CP001053.PE311

CP001053.PE311       Location/Qualifiers
FT   CDS_pept        360587..361492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4309"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bxe:Bxe_B0640 putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4309"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18686"
FT                   /db_xref="GOA:B2TF15"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF15"
FT                   /protein_id="ACD18686.1"
FT                   /translation="MNSRYAGYLYCALAMIGVGSTVVVSKPIAAGLPPFSATALRFAIA
FT                   FPLFVLAMRWRGVRWPRLDRRDTLLVIAQAGAGSVGYTVLLISGMKLASAADAGVIAGT
FT                   LPAVSAGVAVLALGERPAPALIGAILLATAGVLVCTVHPGEFSAPHAVSSLAGNALVFL
FT                   AIVCEALFILLNRKLSTAVAPLPLSALMCGIGFAVALVPACFEKPWALPVDASALGGVL
FT                   YYALVPTVVGFVLWYAGAARISGAEAGLMTALVPVSAVALAAMVLGEPVSAAQLAGVAC
FT                   VLGAVLLATFGQLRMRRSAA"
     atgaactcgc ggtatgccgg atatctgtat tgcgcgctgg cgatgatcgg cgtcggcagc        60
     acggtggtgg tcagcaaacc gatcgcggcc ggactgccgc cgttcagcgc gaccgcgttg       120
     cgcttcgcga tcgcctttcc gctgttcgtg ctggcgatgc gctggcgagg cgtgcgctgg       180
     ccgcgtctgg accggcgcga tacgctgctc gtgattgccc aagcaggcgc ggggagcgtc       240
     ggctacaccg tgctgctaat cagcggcatg aaactcgcct cggccgccga tgcgggcgta       300
     attgccggca ccttgcctgc cgtgtcggcc ggcgtcgccg tgctggcgct cggcgagcgc       360
     cccgcgcccg cgttgatcgg cgcgatcctg ctggcgacgg cgggcgtgct cgtgtgcacc       420
     gtgcatcccg gtgaattcag cgcgccgcat gcggtgagtt cgctggcggg caacgcgctg       480
     gtgttcctcg cgatcgtctg cgaggcgttg ttcattctgc tcaatcgcaa gctgagcacg       540
     gcagtggcgc cgttgccgct gtcggcgttg atgtgtggca tcggtttcgc cgtggcgctc       600
     gtgccggcct gcttcgaaaa gccgtgggcc ttgccggtcg atgcgagcgc actcggcggc       660
     gtgctgtatt acgcgctggt gccgaccgtg gtgggcttcg tgctctggta tgcgggcgcc       720
     gcccggatta gcggcgcgga agcgggattg atgaccgcac tcgtgccggt gagcgcggtg       780
     gcgttggctg cgatggtatt gggtgagccg gtcagcgcgg cgcaactcgc cggtgtcgcg       840
     tgcgtgctgg gcgcggtgtt gctggccact ttcggccagc tgcgcatgag gcggagcgcg       900
     gcatga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page