(data stored in ACNUC7421 zone)

EMBL: CP001053.PE315

CP001053.PE315       Location/Qualifiers
FT   CDS_pept        364325..364984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4313"
FT                   /product="3-oxoacid CoA-transferase, B subunit"
FT                   /EC_number="2.8.3.6"
FT                   /note="KEGG: bxe:Bxe_B0644 3-oxoadipate CoA-transferase
FT                   subunit B (PcaJ); TIGRFAM: 3-oxoacid CoA-transferase, B
FT                   subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4313"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18690"
FT                   /db_xref="GOA:B2TF19"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF19"
FT                   /protein_id="ACD18690.1"
FT                   /translation="MKKLTRDEMAKRVALDIPEGAYVNLGIGVPTLVANHLDADKEIFL
FT                   HSENGLLGMGPAPAKGEEDDELINAGKQHVTLLTGGCYFHHADSFAMMRGGHLDFCVLG
FT                   AFQVSAKGDLANWHTGAPDAIPAVGGAMDLAIGAKQVYVMMEHLTKQGESKIAAECSYP
FT                   VTGVGCVDRIYTDLAMIDVTDRGLVVREIFSDIDFDALHKLTGVPLIDGTQAAHAA"
     atgaaaaaac tgacccgcga tgaaatggcc aagcgcgttg cgctggatat ccccgaaggc        60
     gcgtatgtga acctcggcat cggcgtgcct acgctggtgg ccaaccacct tgacgccgac       120
     aaggaaatct tcctgcatag cgaaaacggc ctgctcggca tgggcccggc gcccgccaaa       180
     ggcgaggaag acgacgaact gatcaacgcc ggcaagcagc acgtcacgct gctcacgggc       240
     ggctgctatt tccaccatgc ggattcattc gcgatgatgc gcggcggcca cctggatttc       300
     tgcgtgctcg gcgcctttca ggtgtcggcc aagggcgatc tggcaaactg gcacaccggc       360
     gcgcccgacg cgatcccggc tgtcggcggc gcgatggatc tggcgatcgg cgcgaagcaa       420
     gtctatgtga tgatggagca cctgaccaag cagggcgaga gcaagattgc cgctgaatgc       480
     tcatacccgg tgacgggcgt gggttgcgtc gaccgcatct atacggatct ggcgatgatc       540
     gatgtcaccg atcggggcct cgtggtgcgc gagattttct cggacatcga tttcgatgct       600
     ttgcacaagc tgaccggtgt gccgctgatc gacggcacgc aggcggcgca cgcggcttaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page