(data stored in ACNUC7421 zone)

EMBL: CP001053.PE319

CP001053.PE319       Location/Qualifiers
FT   CDS_pept        368163..369011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4317"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bxe:Bxe_B0650
FT                   ABC polysaccharide efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4317"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18694"
FT                   /db_xref="GOA:B2TF23"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF23"
FT                   /protein_id="ACD18694.1"
FT                   /translation="MSFTYKHDGREESHPRAHFRDLFLLPWQQRQLIVALTRRDILSRY
FT                   RGSIMGLAWSIVQPLIMLAMYTVVFGTLLKSRWPGTDNSFQFAVILFVGLILFNFFAEC
FT                   LNRAPTIITTNANYVTKVVFPLEILPWITVASAAFHFLTSFAVWLVFALCVYGKLQWTI
FT                   VFLPALFIPLAFVGVGVGWLFAATGVYVRDLTYVTTLLSSLLMFLSPVFYALDTLTPAF
FT                   RALILTNPLTFIIEQARAVMIAGELPDFVGIAIYLSCSIGFAWICLAWFQKTREGFADV
FT                   L"
     atgagcttta cctataaaca cgatggtcgc gaggagtctc atccccgtgc tcattttcgt        60
     gatctctttt tactgccctg gcagcaacgc cagcttatcg tcgcgctaac ccggcgggac       120
     attttgagcc ggtatcgcgg gtcaataatg ggactggcct ggtccatcgt tcagccgtta       180
     atcatgctcg ccatgtacac ggttgtgttc ggcacactgt tgaaatcgcg ctggcccgga       240
     accgacaata gttttcagtt cgcggtgatc ctgttcgtgg gcctgattct tttcaatttt       300
     ttcgccgaat gcctgaatag agcgccgacc attatcacga ccaacgcgaa ctacgtgacg       360
     aaggtcgtct ttcctctcga gatcctgccg tggattacag tcgcctcggc ggcatttcac       420
     ttcctgacga gttttgccgt ctggcttgtc tttgcgctat gcgtatacgg aaagcttcaa       480
     tggacgatcg tctttttgcc ggcgctcttc atcccgctcg catttgtcgg cgtgggtgtg       540
     ggttggctgt tcgccgccac cggcgtctac gtgcgtgacc tgacgtacgt caccacgctg       600
     ctttcatctc tgttgatgtt cctgtcgccg gttttctacg cgctcgatac tttgacgccc       660
     gctttcaggg cgctcattct gaccaatccg ctgacgttca tcatcgagca ggcgcgcgcg       720
     gtcatgattg cgggcgagtt gcctgacttc gtgggcatag cgatctatct gtcatgcagc       780
     atcgggttcg cgtggatctg tctggcctgg ttccagaaga cacgcgaagg tttcgcggat       840
     gttctgtaa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page