(data stored in ACNUC7421 zone)

EMBL: CP001053.PE320

CP001053.PE320       Location/Qualifiers
FT   CDS_pept        369012..370382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4318"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0651 ABC polysaccharide efflux pump, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4318"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18695"
FT                   /db_xref="GOA:B2TF24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF24"
FT                   /protein_id="ACD18695.1"
FT                   /translation="MPMLMEMNQVGKPETTIQVTNASKRFDIYETPLDRLKHIVFPKRT
FT                   GYSREFWALRDVSLSVTRGETVGIIGRNGSGKSTLLQIICGTLRPTQGDIAINGRVAAL
FT                   LELGAGFNLEFSGRENVYLNAAMLGMTSDQIERKFASIEQFAEIGDFIDQPVKTYSSGM
FT                   YVRLAFAVAIHVEPAVLIIDEALAVGDARFQAKCFNKIKELKESGVTILFVSHDVGSVR
FT                   TLCERAVWLDGGRVRMEGGAFAVTAQYTQFMSEGLGESEAIGISSQPAGSAAGLDEEAK
FT                   QNGQTAQNAGRPAATASDEPINHWGTHIGSIVSSQVLDSAGRRQSVFTAFEPMIVRLAI
FT                   QIPEGVDRRALSVAFSIKDTKGTDLIVRTTHDEKGIDFEFDGSEFEIEFRLRNQLNTGR
FT                   YLLVAALEDRSTAVPQYYEYIEGACYFSSYIENDRYGLFLPDITEKIRMDETPLLRR"
     atgccgatgc tcatggaaat gaatcaagtc ggcaagcctg aaaccacgat tcaggtgaca        60
     aacgcctcga agcgtttcga catctacgag acgccgctcg accgtctcaa gcatatcgtc       120
     ttcccaaaac gcaccggcta ttcgcgggaa ttctgggcgc ttcgggacgt atcgctctcg       180
     gtcacacgcg gcgaaacggt gggcatcatc gggcgcaacg gctccggcaa gtccacgctt       240
     ttgcagataa tttgcggaac gcttcgcccc acgcagggtg acatcgcgat taacgggcgt       300
     gtggcggcat tgctcgaatt gggagccggt ttcaatctgg agttttccgg ccgggaaaac       360
     gtctatctga acgccgccat gctgggaatg acgtctgacc agatcgaacg gaaattcgcc       420
     agcatcgagc agtttgcgga aattggcgat ttcatcgatc agccggtcaa aacgtattcg       480
     agcggcatgt atgtgcgcct cgcgtttgcc gtggccattc acgtcgagcc ggcggtcttg       540
     atcatcgacg aagcccttgc ggtgggcgac gcgcgtttcc aggccaaatg cttcaacaag       600
     atcaaggaac tcaaggaatc aggcgtcaca atccttttcg tgtcgcatga cgtcggctcg       660
     gtgcgaacct tgtgtgagcg cgccgtctgg ctcgacggtg gccgggttcg gatggagggt       720
     ggcgcgttcg ccgtcaccgc gcaatacacg cagttcatgt ccgaagggct cggcgaaagc       780
     gaagcgatcg gcatctccag ccagccggcg ggcagcgcgg ccggactgga cgaagaagcg       840
     aagcaaaacg gtcagaccgc gcagaacgcg gggcgccctg ccgcaactgc cagcgacgaa       900
     ccgatcaacc attggggcac acatatcggg tcgatcgtgt cgtctcaggt cctggactcg       960
     gctggtcgcc gccagagcgt gttcacggct ttcgagccga tgatcgtccg cctggcgatc      1020
     cagatccctg aaggcgtcga tcgccgcgcg ctgagcgtgg ctttctccat caaggataca      1080
     aaaggcacgg acctgatcgt ccgaaccact cacgacgaga aaggtattga cttcgagttc      1140
     gacggcagcg agttcgaaat cgagtttcgc ctgagaaacc agctcaacac aggccggtat      1200
     ctgctcgtgg cggctctcga agaccggtcc accgcagtgc cgcagtacta cgagtacatc      1260
     gagggcgcct gctatttctc ttcctacatc gaaaacgatc gatacgggct gttcctgccg      1320
     gacatcacag aaaaaatacg catggacgag acgcctctac tcaggcgctg a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page