(data stored in ACNUC7421 zone)

EMBL: CP001053.PE324

CP001053.PE324       Location/Qualifiers
FT   CDS_pept        complement(375588..376316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4322"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B0653
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4322"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18699"
FT                   /db_xref="GOA:B2TF28"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF28"
FT                   /protein_id="ACD18699.1"
FT                   /translation="MSSTAARKPGATGIRAKQAQDTRAKILKAAIKVFAKQGYASGRVE
FT                   SISKAARSHDRMIYYYFGSKEQLFVEVLETIYTQFNEAESKLDLDLDDPVHGLEQMVEF
FT                   VWQYYLDHPEFVTLLSSENLHQGKHAKKSLKLKEISGYAISVVQKLLDAGQAQQVFRSD
FT                   VKARDVYLMIASLGYFYNANQYTLGAFLGEPLMDKASLDHWREVIKDTVLRAVRSSLPA
FT                   QAGATALTVALNEAGQNSEA"
     atgagttcca ccgccgcccg caagccgggc gccaccggca tccgtgcgaa acaggcgcag        60
     gacacgcgcg ccaagattct gaaagcggcg atcaaggtct ttgccaagca gggctatgcg       120
     agcggacgcg tggaaagtat ttcaaaggcc gcgcgctcgc acgaccgcat gatctactac       180
     tacttcggca gcaaggaaca gttgttcgtc gaagttctcg aaacgatcta tacgcaattc       240
     aacgaggcgg aaagcaagct cgatctcgat ctggacgatc ctgtgcacgg actcgaacag       300
     atggtcgaat tcgtctggca gtattacctc gatcatcccg agttcgtcac gctgctctcc       360
     agcgagaatc tgcaccaggg caagcacgcg aaaaaatcgc tgaagctgaa ggagatttcc       420
     ggctacgcga tttcggtggt gcaaaagtta ctggacgcgg gtcaggcaca acaggtcttt       480
     cgcagcgacg tcaaagcgcg cgacgtctat ttgatgatcg cgtcgcttgg ctatttctat       540
     aacgccaatc agtacacgtt gggcgcgttt ctcggcgagc ctttgatgga caaggcgtcg       600
     ctcgaccact ggcgcgaggt tatcaaggac acggtattgc gcgcggtgcg ctcgagcttg       660
     ccggcgcagg cgggtgcgac ggcgctcacc gttgcgttga acgaggcagg ccagaatagc       720
     gaggcatga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page