(data stored in ACNUC7421 zone)

EMBL: CP001053.PE335

CP001053.PE335       Location/Qualifiers
FT   CDS_pept        389675..390883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4333"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_B0664 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4333"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18710"
FT                   /db_xref="GOA:B2TF39"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF39"
FT                   /protein_id="ACD18710.1"
FT                   /translation="MTTRAGWISRLMVPTVLSLAALSASAQQTIKIGEINSYKAQPAFL
FT                   GPYKNGWNLALDQVNAAGGVLGKQLEVVSRDDNGNPGDTIRVAQELIAREQVQLLFGGF
FT                   LSNTGLALTDFAKQKKIFFLAAEPLTDKIVWADGNKYTYRLRPSTYMQVAMLVPEAAKL
FT                   HKKRWALVYPNYEYGQSAVATFKKLLTAAQPDVQFVAEQATPLGNVDAGAVTQAIADAK
FT                   PDAIFNVLFGADLGKFVREGNTRGLFKDRSVVSLLTGEPDYLDPLGAEAPTGWIVTGYP
FT                   WYSIDTAANKKFVDAYQAKYHDYPRLGSVVGYSALMSIAAGIKKAGSVDPDKLAAAFKG
FT                   LGVDTPFGPITYRAQDNQSTMGAYVGVTGLKDGKGVMTSYRYIDGASVQPSDAEVKKLR
FT                   PAE"
     atgaccacgc gcgcaggatg gatctctcgc ctcatggtgc caacggtgct ctcgctcgcc        60
     gccttgagtg cgagcgcaca gcagaccatc aagatcggcg agatcaacag ctacaaggcg       120
     cagcccgcct ttctcgggcc ttacaagaac ggctggaatc tcgcgctcga ccaggtgaac       180
     gccgcgggcg gcgtgctcgg caaacagctc gaagtggtgt cgcgcgatga caatggcaat       240
     ccgggcgaca cgattcgcgt cgcgcaggaa ctgatcgcgc gcgagcaggt gcaattgctg       300
     ttcggcggct ttctctcgaa caccggcctc gcgctgactg acttcgccaa gcagaagaag       360
     attttcttcc tcgccgccga gccgctgacc gacaagatcg tctgggccga tggcaacaaa       420
     tacacgtacc gtctgcggcc ttcgacgtat atgcaggtgg cgatgctggt gccggaagcc       480
     gccaagctgc ataagaagcg ctgggcactc gtgtatccga actacgagta cgggcaatcg       540
     gcggtggcga ccttcaagaa gctgctgacg gcggcgcagc ctgacgtgca gttcgtcgcc       600
     gagcaggcca cgccgctcgg caacgtcgac gcgggcgcgg tgacgcaggc gatcgccgac       660
     gccaagccgg atgcgatctt caacgtgctg ttcggcgccg acctcggcaa gttcgtgcgt       720
     gagggcaata ctcgcgggct cttcaaggat cgcagcgtgg tgtcgctgct gacgggcgag       780
     ccggattatc tcgacccgct aggcgccgaa gcgccgaccg gctggatcgt gacgggctat       840
     ccgtggtact cgatcgatac cgcagccaac aagaagttcg tcgatgcgta tcaggccaag       900
     tatcacgact atccgcggct cggctcggtg gtggggtatt cggcgttgat gtcgattgca       960
     gcgggcatca agaaggcggg gtcggtcgat ccggataagc tcgccgccgc gttcaagggc      1020
     ctcggtgtgg acacgccgtt cgggccgatc acctatcgcg cgcaggacaa tcagtcgacc      1080
     atgggcgcgt atgtcggcgt gacgggtttg aaggacggca agggcgtgat gacctcgtac      1140
     cggtatatcg atggcgcgag cgttcagccc tcggatgccg aggtcaagaa gctgcggcct      1200
     gccgagtaa                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page