(data stored in ACNUC7421 zone)

EMBL: CP001053.PE336

CP001053.PE336       Location/Qualifiers
FT   CDS_pept        complement(391009..391260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4334"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18711"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF40"
FT                   /protein_id="ACD18711.1"
FT                   /translation="MKIPTVRAAAHIEGVHWIAEYAEDVHEIRVFREGQEVDVHNAPST
FT                   LFGDEENAGSKSTADHRAVEAAVLAYLKRFVIEHDAEE"
     atgaagatac ctaccgtacg tgccgccgcg catatcgagg gcgtgcactg gatcgccgag        60
     tacgccgaag acgtccacga gattcgcgtc tttcgcgaag gccaggaagt ggatgtgcac       120
     aacgcgccgt ccaccctgtt cggcgacgag gaaaatgcgg gctccaaaag caccgcggat       180
     catcgcgcgg tcgaagccgc cgtattggct tatctgaaac gattcgtgat cgagcacgac       240
     gcggaggagt ag                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page