(data stored in ACNUC7421 zone)

EMBL: CP001053.PE337

CP001053.PE337       Location/Qualifiers
FT   CDS_pept        391439..391993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4335"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bxe:Bxe_A1388 sigma-24 (FecI)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4335"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18712"
FT                   /db_xref="GOA:B2TF45"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF45"
FT                   /protein_id="ACD18712.1"
FT                   /translation="MTERDTDITATVVRERTRLVNFIRRRIRDPDDAEDILQDVFHEFV
FT                   QAYRLPAPIEQASAWLFRAARNRIVDRFRKKKEQPLADLSASGDDADSEYRLDLDLPAH
FT                   DAGPEALYARALLLKALQDALDELPANQREVFVAHELEGRSFKEMAAESGVTLNTLLAR
FT                   KRYAVLHLRARLQAICDELGI"
     atgaccgaac gagacaccga catcaccgcg accgtggtgc gtgagcgcac gaggctcgtc        60
     aattttatcc ggcgccgaat tcgcgaccca gacgatgccg aggacattct gcaggatgtg       120
     ttccacgaat tcgtgcaggc ttaccggctt cccgcgccga tcgaacaggc gagtgcgtgg       180
     ctgttccgtg ccgcgcgcaa tcgcatcgtc gatcggtttc gcaagaagaa agagcagccg       240
     ctggcagatc tgtccgcgag cggagacgac gccgacagtg agtatcgcct cgacctcgac       300
     ctgccggcgc acgatgcggg tcccgaagcc ctctacgcgc gcgctctatt gctgaaggcc       360
     ttgcaggacg cgctcgatga gttgccagcg aatcaacgtg aggtctttgt cgcgcacgaa       420
     ctggagggcc ggtccttcaa ggagatggcg gcggaaagcg gcgtcacgct caatacgttg       480
     ctcgcgcgca aacgctatgc ggtcttgcat ctgcgtgcgc ggctgcaggc catttgtgac       540
     gaactgggta tctaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page