(data stored in ACNUC7421 zone)

EMBL: CP001053.PE338

CP001053.PE338       Location/Qualifiers
FT   CDS_pept        392006..392314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C6639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4336"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18713"
FT                   /db_xref="GOA:B2TF46"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF46"
FT                   /protein_id="ACD18713.1"
FT                   /translation="MNFRIRCAGKALLVVVAIGVLGWVVMTLWNWVIPALFVGARAIDF
FT                   AHALGLLVLSRILFGGFRGHGGWRERRRWRKWEAMTPEEREHFQTAWRSGRDRRAGD"
     atgaattttc gaatcagatg tgcgggtaag gcactgcttg tggtggtcgc tatcggcgtg        60
     ctcggctggg tggtcatgac gctatggaat tgggtgattc cggcgctatt cgtcggcgct       120
     cgtgcgatcg acttcgccca tgcgttgggc ttgctggttt tgagccgcat cctgttcggc       180
     ggattccgcg gacatggcgg ctggcgcgaa cggcgtcgct ggcgcaaatg ggaagcgatg       240
     acacccgaag aacgcgagca tttccagacg gcatggcgat cgggccgcga ccggcgggcg       300
     ggagattga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page