(data stored in ACNUC7421 zone)

EMBL: CP001053.PE344

CP001053.PE344       Location/Qualifiers
FT   CDS_pept        complement(397332..397955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4342"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bxe:Bxe_B0672 amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4342"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18719"
FT                   /db_xref="GOA:B2TF44"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF44"
FT                   /protein_id="ACD18719.1"
FT                   /translation="MSYLSLSALPAGILFALVTTITPGPNNTMLLASGVNFGFRRTLPH
FT                   LSGISAGVVLLMLSVGIGLGEAFVHFPVLYTVLEVASVAYLLYLAWKIGTSGELKMKKG
FT                   ERRPMKFYEAIAFQWVNPKAWMMVLTAATTIHLSESYSMNAIAMAVIFYVIGFPCICLW
FT                   AGFGTAMRQVLSDPKRLRIFNVAMALLLVLSLYPIALKLIGQSA"
     atgtcatacc tcagtctcag cgcgctgcct gccggcatcc tgttcgcgct cgtcaccacc        60
     attacgcccg gtccgaacaa cacgatgttg ctggcctccg gggtcaactt cggatttcgg       120
     cgcacgttgc cgcatctgtc cggcatcagc gctggcgtcg tgctgttgat gctgtcggtc       180
     gggatcggtc tgggggaagc cttcgtgcat ttccccgtgc tgtacacggt gctcgaggtc       240
     gcgagcgtcg cttatctgct gtacctcgcg tggaagatcg gtacctcggg tgagctgaag       300
     atgaaaaaag gcgagcgccg gcccatgaag ttctacgaag cgatcgcctt ccagtgggtc       360
     aatccgaagg catggatgat ggtgctgacc gccgccacga cgatccacct cagcgagagc       420
     tacagcatga acgctatcgc gatggcggtg atcttctacg tgatcggctt tccgtgcatc       480
     tgcctgtggg cgggtttcgg caccgccatg cggcaggtgc tgtcggatcc gaagcgcttg       540
     cgcatcttca atgtggcgat ggcgctgctg ctggtgctgt cgctgtatcc gatcgcgctg       600
     aagctgatcg ggcagtcggc ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page