(data stored in ACNUC7421 zone)

EMBL: CP001053.PE345

CP001053.PE345       Location/Qualifiers
FT   CDS_pept        398332..399021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4343"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: bur:Bcep18194_B0419
FT                   ferredoxin/oxidoreductase FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4343"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18720"
FT                   /db_xref="GOA:B2TF49"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF49"
FT                   /protein_id="ACD18720.1"
FT                   /translation="MHDKFLSVVVTRKWQLAESYHAVELQTRCRSELPSFDDGSCVTLV
FT                   RDDVICKEKIYPLCRFTSRPRAYVIAVRQDDADTDAKTADISLSQGDEAFIVTTRSPTV
FT                   ILDGRTQSLLFAGGVGAASIAGIATRLALAGQKFELHNFARSPERAVFRNELDALKSES
FT                   RVYHHFGLDADRLEQATSHAISPVQANTQIYCSGPPAFMDLIERQARDWVYPANIHKIF
FT                   LGDRRSA"
     atgcacgaca aattcctctc agtcgtcgtt acacggaaat ggcaacttgc cgagagttat        60
     cacgccgttg aacttcaaac cagatgcaga tccgaactgc cgtcgtttga cgatgggtct       120
     tgcgtcacac ttgttcgcga cgatgtcatc tgcaaagaga aaatatatcc cctgtgccgt       180
     tttacttctc ggccgcgtgc gtacgtcatc gccgtgagac aagacgatgc cgacacggat       240
     gcgaaaacag cggacatttc gttgagtcaa ggcgacgagg cgtttatcgt gacgacacgc       300
     agtcctacgg ttattttgga cggccgtacc caatcgttac tgtttgcggg aggtgtcggc       360
     gcggcgtcga tcgcggggat tgcgacacgg ctggcgttgg cggggcagaa attcgagttg       420
     cacaactttg cccggtctcc tgaacgagca gtctttcgga atgagctaga cgcgctcaaa       480
     agcgaaagtc gggtttatca ccattttggt ctggatgctg accgactgga gcaggcgact       540
     tctcacgcga taagcccagt gcaggctaac actcagattt actgcagtgg tccgccggcg       600
     tttatggatc tcatcgagcg tcaggctcgc gactgggtgt atccggccaa tatccacaaa       660
     attttcctgg gtgacagaag aagcgcatag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page