(data stored in ACNUC7421 zone)

EMBL: CP001053.PE348

CP001053.PE348       Location/Qualifiers
FT   CDS_pept        complement(400778..401656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4346"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: mlo:mlr1895
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4346"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18723"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF52"
FT                   /protein_id="ACD18723.1"
FT                   /translation="MQQRNYLVTAAAGKTGVHTVRHLLEGGHGVRALVHREDERSAALR
FT                   KAGAEVIVGDLLEHDDAIRATEGVSGAYLCYPVRPGFIQATAYFADAARRANLDVVVNM
FT                   SQISAREDSKSHAARDHWIAERVLDWSGVPTVHLRPTFFSEWLTFPWVRDPIVKEGKIA
FT                   LPYGNGRHAPISAEDQARVIAAILAQPSTHIGKTYPLYGPVELSQQEIADAVGNVSGRK
FT                   IVYSPTSIEDYRKHLETYGLPEFMIQHFLEVAIDYQNGIFAGTNDVIEKITGQAPQTID
FT                   AFVAANREAFQ"
     atgcaacaac gcaactatct ggtaacagcc gccgctggca agactggcgt gcacacagtc        60
     cgtcaccttc ttgaaggcgg tcacggcgtt cgcgcccttg tccaccgcga ggacgaaaga       120
     agcgcagcgc ttcgaaaggc cggcgccgaa gtcatcgtgg gtgatcttct ggaacacgac       180
     gatgcgatac gcgccacgga gggcgtttcg ggcgcctacc tgtgctatcc cgtgcgtccg       240
     gggttcattc aggcaaccgc atacttcgcg gacgcggcgc ggcgcgcaaa tctcgacgtc       300
     gtggtgaaca tgtcgcagat ctccgctcgc gaagactcga agagtcacgc tgcccgcgat       360
     cactggatcg cagagcgtgt tctggactgg tcgggcgtgc cgaccgtcca cctccgcccc       420
     acgttcttct cggaatggct gacgtttccg tgggtgcgcg accccatcgt gaaagaagga       480
     aagattgcgc ttccttacgg caacggacgc catgcaccga tctccgccga agaccaggcg       540
     cgagtgatcg cagcgattct cgctcagccg tcaacgcata tcggcaagac gtacccgctg       600
     tatggtcccg tcgaactcag ccagcaggag atcgccgacg cggtcggcaa tgtgtcgggc       660
     cgcaaaatcg tctacagccc gacaagcatc gaggactatc gcaagcatct ggaaacatac       720
     ggtctgcccg aattcatgat ccagcatttt ctggaagtgg caatcgacta ccagaacggc       780
     atcttcgctg gtaccaacga cgtgatcgaa aagatcaccg gacaagcgcc gcaaacaatc       840
     gacgcatttg tcgccgccaa tcgcgaggcg ttccagtaa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page