(data stored in ACNUC7421 zone)

EMBL: CP001053.PE351

CP001053.PE351       Location/Qualifiers
FT   CDS_pept        complement(403391..404143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4349"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: dihydrodipicolinate reductase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein;
FT                   KEGG: reu:Reut_A1579 NAD-dependent
FT                   epimerase/dehydratase:dTDP-4-dehydrorhamnose
FT                   reductase:NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4349"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18726"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF55"
FT                   /protein_id="ACD18726.1"
FT                   /translation="MKIVVIGGSGLIGSRLVTLLGEAGHEAVAASPRTGVNAVTGEGLS
FT                   NALVGADVVMDVTNAPSWEPQAVLDFFRTSARNLGKAEAAAGVRHHVALSIVGCDRSPK
FT                   NAYFAAKVAQEELIRAAGVPYTIVRATQFMEFIGGIADFSTVDGTVRIGEGLFQPIAVD
FT                   DVVANLAQVALAAPQNGTVEIAGPDRAPFAEIVSRFLKSVGDARPVVTDRDALYYGDRV
FT                   EEQSLVPLGDARIGRVSLDQWFARAKNG"
     atgaaaatcg tcgtaatcgg tgggtccggc ctgatcggat cgcgtcttgt cacgctgctg        60
     ggcgaagcag gccatgaagc ggtcgctgcg tcgccgcgta ctggtgtcaa cgctgtgacc       120
     ggcgagggtc tgagcaatgc gctcgtgggc gcggacgtcg taatggatgt gacaaacgcg       180
     ccgtcatggg agccgcaggc ggtactcgac ttcttccgca cttcggcgcg caatcttggc       240
     aaggccgaag cggctgcggg agtgcgccat cacgtggcgc tctccatcgt cggctgcgac       300
     cgctcgccga agaacgcgta tttcgctgcc aaggtcgcgc aggaggaatt gatccgggca       360
     gccggcgtgc cgtacacgat cgtgcgcgcg acgcagttca tggagttcat cggcggtatc       420
     gcggatttca gcacggtcga cggcacggtg cgtatcggcg aaggactgtt tcaaccgatc       480
     gccgtggatg acgtcgtcgc caaccttgcg caggtcgcgc tcgctgcgcc gcaaaacggc       540
     acggtcgaga ttgccggccc ggaccgcgca cccttcgcgg agatcgtctc gcgttttctg       600
     aagtcggtgg gcgacgcgcg cccggtggtg acggatcgcg atgcgctgta ttacggcgac       660
     cgcgtcgagg aacaatcgct cgtgccgctc ggcgatgcac ggattggccg cgtcagtctc       720
     gaccagtggt tcgcgcgcgc aaagaacggt tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page