(data stored in ACNUC7421 zone)

EMBL: CP001053.PE353

CP001053.PE353       Location/Qualifiers
FT   CDS_pept        complement(405979..406653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4351"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   mms:mma_1228 acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4351"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18728"
FT                   /db_xref="GOA:B2TF57"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF57"
FT                   /protein_id="ACD18728.1"
FT                   /translation="MRILLINASPHGEASHGYRFADEIVGMLHGHAAPAASAITVVERD
FT                   LAAAPLPPIARDYARAVTSRAPDTAHFDVSEQLIGEIETTDALIINTPMHNFTVPAALK
FT                   LWIDYTLRIHRTFASTPEGKVGLMRDRPTIVIVGSGGVHSGERARQTDFLTPYLRYALG
FT                   SIGIHSVQFLLLQGLVMGEATVAKALDAARVQLTGDAVFVSLAAQASRCARTAAGSTAR
FT                   SA"
     atgagaatct tgctgatcaa tgccagcccg catggtgaag cgagccacgg ctaccgtttc        60
     gccgacgaaa tcgtcggcat gctgcacggg cacgccgcac ccgccgcctc ggccatcacc       120
     gtggtcgagc gcgacctggc ggccgcgccg ctgccgccga tcgcccgcga ttacgcacgc       180
     gccgtcacgt cgcgcgcgcc ggatacggcg catttcgatg tctccgagca actgatcggt       240
     gaaatcgaaa ccacggatgc gctcatcatc aacacgccga tgcacaactt cacggtcccg       300
     gcagcgctca agctgtggat cgattacacg ctgcgcattc atcgcacgtt cgcctcgacg       360
     ccggagggca aggttggact gatgcgcgac cggccgacca tcgtgatcgt cggttcgggc       420
     ggtgtgcata gcggcgaacg cgcgcggcag acggatttcc tgaccccgta tctgcgctac       480
     gcgctcggct cgatcggcat tcacagcgtg cagtttcttc ttttgcaggg gctcgtgatg       540
     ggcgaagcga ctgtggccaa agcgctcgat gcggcgcgcg ttcagcttac cggcgacgca       600
     gtgttcgtct cgcttgccgc gcaggcttcc cgatgcgcga ggacggcggc cggtagtact       660
     gcacggagcg catag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page