(data stored in ACNUC7421 zone)

EMBL: CP001053.PE354

CP001053.PE354       Location/Qualifiers
FT   CDS_pept        complement(406650..407117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4352"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pfl:PFL_2190 PhnO-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4352"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18729"
FT                   /db_xref="GOA:B2TF58"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF58"
FT                   /protein_id="ACD18729.1"
FT                   /translation="MPASLRFVHLDTPELLLPAFDVMRQLRPHLTDAHSFAAQVARQHA
FT                   DGYRLLAASDASGIVGLAGYRILTNLLYGRFVYVDDLVVDGKLQRDGIGAQLLDAVRQI
FT                   AREAGCVQFVLDTGLHMPLAQRFYFRNGLLARGMHFVEPLAPLSPASALTP"
     atgcccgcct cgcttcgctt cgttcacctc gacacgcccg agttactgct ccccgcattc        60
     gacgtcatgc gtcagttgcg accgcatctc accgacgcgc attcgttcgc cgcacaggtg       120
     gccagacagc atgccgacgg ctatcgcctg ctcgctgctt ccgacgcgag cggcatcgtc       180
     ggcctcgccg gttatcgcat cctgaccaat ctgctgtacg gccgcttcgt ctatgtcgac       240
     gatctcgtgg tggatggcaa gctgcaacgt gacggcatcg gcgcgcaact gctcgacgcg       300
     gtacggcaga ttgcgcgcga agcgggctgc gtgcaattcg tgctcgacac gggtctgcac       360
     atgccgcttg cgcagcgctt ttatttccgt aacgggctgc tcgcgcgagg catgcacttc       420
     gtcgagcccc tcgcccctct ttcccctgct agcgcgctca cgccatga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page