(data stored in ACNUC7421 zone)

EMBL: CP001053.PE356

CP001053.PE356       Location/Qualifiers
FT   CDS_pept        408334..409197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4354"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: bam:Bamb_6112 NmrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4354"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18731"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF60"
FT                   /protein_id="ACD18731.1"
FT                   /translation="MYAITGITGKVGGAVARTLLAAGQPVRAVVRDATRARSWAERGCE
FT                   VVTANMDNAGSLTAAFEGTQGVFILPPPEFDPSPGFPEARAVIDAVRGALQSVAPGKVV
FT                   CLSTIGAHATETNLLTQLTLMEQALRDLPMPVTFLRPGWFMENAAWDVAPARDNGVISS
FT                   FLQPLDRAVPMVATADVGRVAAQLLLQTWRGVRVVELEGQRVSPNDLAQTFAKVLGCPV
FT                   RAEAVPRETWDALFRSQGMKEPLPRMRMLDGFNEGWICFEGDPADIVKGEVELETVLRD
FT                   LVSQSV"
     atgtatgcaa tcacagggat aacagggaag gtcggcggcg cggtagcgcg cacgttgctc        60
     gccgcgggcc agccggtgcg cgcggttgta cgcgatgcca cccgggcacg ctcgtgggct       120
     gaacgcggat gtgaagtggt gaccgccaac atggacaatg cgggctcgct taccgccgct       180
     ttcgagggca cgcaaggcgt cttcattctg ccgccgccgg agttcgatcc gtcgcccggc       240
     tttcccgagg cgcgcgctgt cattgacgcc gtgcgcggtg cgcttcaatc ggtggcgccc       300
     ggcaaggtgg tttgcctgtc gacgatcggc gcgcacgcca ccgaaaccaa tctgctcacg       360
     caacttacgc tgatggagca ggcgcttcgc gatttgccga tgcccgtgac ttttttgcgt       420
     cccggctggt tcatggaaaa cgccgcatgg gacgttgcgc cggcgcggga caacggagtg       480
     atctccagct ttctgcaacc gctcgacagg gctgtgccga tggtcgcgac cgcggacgtc       540
     ggtcgcgttg ccgcgcaact gcttctgcag acctggcgcg gcgtgcgtgt cgtcgagttg       600
     gaagggcaac gcgtgagccc gaacgatctg gcgcagacat ttgccaaggt gctcggttgc       660
     ccggttcgtg cggaggcggt gccgcgcgaa acatgggacg cgctgtttcg atctcaaggt       720
     atgaaggagc cgttgccgcg tatgcgcatg ctcgacggat tcaatgaagg ctggatctgt       780
     tttgagggcg acccagccga catcgtcaag ggcgaagtgg agctggagac cgttctgcga       840
     gatctcgtct cgcagtcggt ctaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page