(data stored in ACNUC7421 zone)

EMBL: CP001053.PE357

CP001053.PE357       Location/Qualifiers
FT   CDS_pept        409401..409805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4355"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bur:Bcep18194_C7168
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4355"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18732"
FT                   /db_xref="GOA:B2TF61"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF61"
FT                   /protein_id="ACD18732.1"
FT                   /translation="MTDITTSMKLNHMSFPSSDVSATATFFENHLGCTVAARGTSWFLK
FT                   RPGFDIVIDDAAGHPVEWPHNFHIGFELASLDEVRALYEQMAGAGVVMKTGVFKHERGS
FT                   RFFCEVPGGVLVEINTRSDADEKYRGTFDL"
     atgaccgata tcaccaccag catgaagctc aatcacatga gcttcccttc atccgatgtg        60
     agcgccaccg ccaccttttt cgagaaccat ctaggctgta cggttgccgc gcgagggacg       120
     agctggtttc tgaaacgccc cggtttcgac atcgtgatcg atgacgccgc cggccatccg       180
     gtcgagtggc cgcacaactt tcatatcggc ttcgagctgg cttctctcga cgaggttcgc       240
     gcgctctacg agcagatggc cggcgccggc gtcgtgatga agaccggcgt gttcaagcat       300
     gagcgcggct cgcggttttt ctgcgaggtg cccggtggcg ttctcgtcga aatcaacacg       360
     cgttcggacg ccgacgagaa atatcgcggc actttcgacc tctaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page