(data stored in ACNUC7421 zone)

EMBL: CP001053.PE365

CP001053.PE365       Location/Qualifiers
FT   CDS_pept        416613..418028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4363"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_B0685 putative taurine dehydrogenase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4363"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18740"
FT                   /db_xref="GOA:B2TF69"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF69"
FT                   /protein_id="ACD18740.1"
FT                   /translation="MEHSEIERVAQGMPSGRADDTRYDPAYDPLVSPGPGWGKQYAPTY
FT                   WVATAGTPPEDDGPITADVDVDVAIIGGGYTGLATALCLAREHGIKAVVLEANKTSWGC
FT                   SSRNGGQGQNASGRLSRSQWIERWGKDVALKMHDEIQEGFDNFKSLVAEIDCDPQPGGH
FT                   FLIAHRPRIMQKLAAEAKVWKDVFGYPSELIDKQTFQREYVNDHEAAGALHEPEGIGIH
FT                   ALKLAFGYLRLAREAGAKVHPASPVLGWETINGVHHLRTPGGIVRARAVGIATGAYTAQ
FT                   TLHNSLRSRIMPILSNSMVTRPLTKQEIDACNFRTTQVLTDTRTLRFYYRFLPDNRLQI
FT                   GSRSAITGADAPNSRHYDLLMEGMLRKFPALRGVAIDYSWWGWVDVSHDMMPRVYQPDP
FT                   MQTVYYALGYGGNGVSYSQQAGRRLAERIAGKGAKQTLPIFTSPLPGHPFAPFRRIGQR
FT                   MLYQLYFRRDEKP"
     atggagcaca gtgaaatcga acgggtcgcg caaggcatgc cgtccggccg cgcagacgat        60
     acgcgctacg acccggcgta cgacccgctg gtgtcgcccg ggccgggctg gggcaagcaa       120
     tacgcgccga cctactgggt tgcgaccgcg ggcacgccgc ccgaagacga tggcccgatc       180
     accgcggatg tcgacgtgga tgtggcgatc attggcggcg gctataccgg gctcgccacg       240
     gcgctctgtc tcgcgcggga gcacggcatc aaggctgtcg tgctggaagc caacaagacg       300
     agctggggct gcagcagccg caacggcggc caaggtcaga acgcctcggg ccggctgtcg       360
     cgttcgcaat ggatcgagcg ctggggtaaa gacgtcgcgt tgaaaatgca cgacgagatt       420
     caggaaggtt tcgataattt caagtcgctg gtcgcggaga tcgattgcga tccgcaaccc       480
     ggtggccact ttctgatcgc gcaccggccg cgcatcatgc agaagctcgc cgccgaggcc       540
     aaagtctgga aggacgtgtt cggctatccg tccgagctga tcgacaagca gaccttccag       600
     cgcgaatacg tcaacgatca cgaagcagcg ggcgcgctgc acgagcccga aggcatcggc       660
     attcatgcgt tgaagctcgc cttcggttat ctgcggctgg cccgcgaagc gggcgccaag       720
     gtgcatccgg cgagcccggt gctcggctgg gaaacgatca acggtgtgca tcatttgcgc       780
     acgcctggcg gcatcgtgcg ggcacgcgcg gtcggcattg caacgggcgc gtacacggcg       840
     caaacgctgc acaactcgct gcgcagccgc atcatgccga tcctgtcgaa ttcgatggtc       900
     acgcggccgc tcacgaagca ggaaatcgac gcgtgcaact ttcgcacgac ccaggtgctg       960
     accgatacgc gcacgctgcg cttctactat cgttttctgc cggacaaccg tttgcagatc      1020
     ggcagccgtt ccgcgatcac cggcgccgac gcgcccaatt cgcgccatta cgatctgctg      1080
     atggaaggca tgttgcgcaa gtttccggcc ctgcgcggcg tcgcgatcga ttattcatgg      1140
     tggggctggg tggacgtcag ccacgacatg atgccgcgcg tgtatcagcc ggatccgatg      1200
     cagaccgtgt actacgcgct cggctacggc ggcaacggcg tgtcgtattc gcagcaggcc      1260
     gggcggcggc tggccgaacg catcgcggga aagggcgcga aacagacgtt gccgatcttc      1320
     acgtcgccat tgcccgggca cccgttcgcg ccattccggc gaatcggcca gcggatgctg      1380
     tatcaactgt atttccggcg cgacgaaaaa ccgtga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page