(data stored in ACNUC7421 zone)

EMBL: CP001053.PE37

CP001053.PE37        Location/Qualifiers
FT   CDS_pept        42010..43176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4026"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG:
FT                   bxe:Bxe_B0485 squalene/phytoene synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4026"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18412"
FT                   /db_xref="GOA:B2TE91"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE91"
FT                   /protein_id="ACD18412.1"
FT                   /translation="MGRDRSAAHGRGASPYTIRQRLIFCPFFARFLHNSDLIPSMPNPT
FT                   RAFLLGPLLKGVSRSFYLTLRVLPVGMRDPIGLAYLLARAADTIADTSLISPEQRLALL
FT                   LSLRAQVNGATDDVALFQRMAAEVAGQQDQSDEKVLLESLGPALDVLSQLSESDRKAVR
FT                   EIVSTLTEGMEFDLRTFPDERSGQIAALREYDELDRYTYLVAGCVGEFWTTMTYAHMPG
FT                   TLKERPETMARRGVRFGKALQMTNVLRDCGKDLRIGRCYLPQTLLDRYGLSVQDLLVPA
FT                   NSVRARPLMLELLRTTLDHFRDALDYTLAIPAFSVRLRLACLWPILIGLETLLLLVDNA
FT                   AWLDPQKVSKVRRNRVYQIIASSLLLVPSNGLVRNAIEQRIRQIEARL"
     atggggcggg acaggtccgc cgcgcacggc agaggcgctt cgccgtatac aattcggcag        60
     cgcctgattt tttgcccgtt ttttgcccgc ttcctgcaca actccgacct gatcccatcc       120
     atgccgaatc cgacccgggc cttccttctc ggcccgctcc tgaaaggcgt ttcacgctcc       180
     ttctatctca ccctgcgcgt gctgcccgtc gggatgcgcg atccgatcgg actcgcttac       240
     ctgctggcgc gcgcggccga cacgatcgcc gacacctcgc tgatctcgcc ggaacaacgc       300
     cttgccttgc tgctgtcact gcgcgctcag gtgaacggcg caacagacga cgtggcgcta       360
     ttccagcgca tggccgcgga agtggcgggg cagcaggacc agtcggacga gaaagtgctg       420
     ctcgaatcgc tcggccccgc gctcgatgtg ttgtcgcaac tgagcgaatc ggatcgtaag       480
     gctgtccgcg agatcgtttc gacgctgacc gaaggcatgg agttcgatct tcgcaccttc       540
     cccgacgaac gttccggtca gatcgcggcg ctacgcgaat acgacgaact cgaccgctac       600
     acgtacctcg tggcgggctg cgtcggcgaa ttctggacca cgatgaccta cgcgcacatg       660
     cccggcacgc tgaaggagcg gcccgagacg atggcacggc gcggcgtgcg cttcggcaag       720
     gcgctgcaga tgaccaacgt gctgcgcgat tgcggcaagg atctgcggat cggccgctgt       780
     tatctgccgc agaccttgct cgaccgatat ggtctaagcg tgcaggattt gttggtgccg       840
     gctaattcgg tgcgtgcccg gccgctgatg ctcgagcttt tgcgcacgac cctcgatcat       900
     ttccgtgacg ccctcgatta cacgttggcg attcctgcgt tctccgtgcg tttgcggctc       960
     gcctgtttgt ggccgattct gattggtctg gagacgctgc tcctgctcgt ggacaacgct      1020
     gcctggctcg atccgcagaa agtgtcgaaa gtgcggcgta atagggtgta tcagatcatc      1080
     gcgtcgtcgc tgttgctggt gccttcgaat ggactggtgc gcaacgccat tgaacagcga      1140
     atcaggcaaa tcgaagcccg cctttga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page