(data stored in ACNUC7421 zone)

EMBL: CP001053.PE374

CP001053.PE374       Location/Qualifiers
FT   CDS_pept        complement(429140..429955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4372"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0693 ABC taurine transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4372"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18749"
FT                   /db_xref="GOA:B2TF78"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF78"
FT                   /protein_id="ACD18749.1"
FT                   /translation="MENMTVRNVSVVFPGRRPGQTVQALDDINLTIRSGDFVVALGASG
FT                   CGKTTLLSLMAGFIAPSRGELLLGGEPIAGPGADRGVVFQKHALLPWLNVIDNAEFGLK
FT                   LQGVPRAQRREIAVRNLALVGLQDFHKHMIYQLSGGMQQRVGIARALTCDPAMLLMDEP
FT                   MAALDALTRETIQELLLDVWKKTNKMFFFITHSVEEALFLASRLIVMSPRPGRITHTYE
FT                   LDFNRRFLESRDARAIKSSPDFIAMREQVLNIIYGDEKMHAAEAGVAHV"
     atggaaaaca tgactgtcag gaacgtgagc gtggtatttc cggggcggcg ccccggccag        60
     accgtgcagg cgctcgacga tatcaacctg accatccgct cgggtgactt cgtggtcgcg       120
     ctgggtgcgt cgggctgcgg caagaccacg ctgttatcgc tgatggccgg tttcatcgcg       180
     ccgagccgcg gcgagttgct gctcggcggc gaacctattg cggggccggg ggcggaccgc       240
     ggcgtggtgt tccagaagca tgcgctgttg ccatggctca acgtgatcga caacgcggaa       300
     ttcggcctca agctgcaagg cgtgccacgc gcgcaacggc gcgaaattgc cgtgcgcaat       360
     cttgcgctgg tgggcttgca ggacttccac aagcacatga tctaccagct ctccggcggc       420
     atgcagcagc gcgtcgggat tgcccgcgcg ctcacctgcg atccggcgat gctgctgatg       480
     gacgagccga tggccgcgct cgacgcgctc actcgcgaga ccattcagga gcttctgctc       540
     gacgtgtgga agaagaccaa caagatgttc ttcttcatca cgcacagtgt ggaggaagca       600
     ctgttccttg cgagccggct catcgtgatg tcgccgcgtc ccggccgtat cacgcatacc       660
     tacgaactgg acttcaaccg ccgttttctc gaatcgcgcg acgcacgggc gatcaaatcg       720
     agtcccgatt tcatcgcaat gcgcgagcag gttctcaaca tcatctacgg cgacgagaaa       780
     atgcatgccg ccgaggccgg agtcgctcat gtttag                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page