(data stored in ACNUC7421 zone)

EMBL: CP001053.PE375

CP001053.PE375       Location/Qualifiers
FT   CDS_pept        complement(429989..431047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4373"
FT                   /product="taurine ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="KEGG: bxe:Bxe_B0694 ABC taurine transporter,
FT                   periplasmic ligand binding protein; TIGRFAM: taurine ABC
FT                   transporter, periplasmic binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4373"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18750"
FT                   /db_xref="GOA:B2TF79"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF79"
FT                   /protein_id="ACD18750.1"
FT                   /translation="MKRHKNSTLRPWFQWTARCVLSLVCAATACFATTPAHAEDKEITI
FT                   AYQQIVDPWVVGIANGSIEKATGYKINWRQFESGAKVATALASGDVKVGVIGSSPLAAA
FT                   VSQGLDLQLFWILDNINQAEAMVVRNGSGITKPADLKGKTIGVPFVSTTHYHTMFALQH
FT                   WGINPSDLKILNMQPNQIVAAWSRGDIDAAYVWDPALAELKKSGKVLITSGDLSKLGKP
FT                   TFDGIAVDRKWGEEHKDFMAKLVKAIADADQQYRSNPSQWNASSPQAAAIAKMIGGSPA
FT                   DVPASLALYAFPTLSEQASAQWLGGGTTSRAALALKDTSEFLKSQKQIGTVLPDYSKFV
FT                   TPAYAEAAAQLK"
     atgaaacgcc ataaaaactc gacattgcgg ccgtggttcc aatggacggc gcgctgcgtc        60
     ctgtcgctgg tttgcgccgc cacggcgtgt ttcgccacga cgcccgccca cgctgaagac       120
     aaggaaatca cgatcgccta ccagcagatc gtcgacccct gggtggtcgg catcgcgaac       180
     gggtcgatcg aaaaggccac gggttacaag atcaactggc ggcaattcga atccggggca       240
     aaagtggcga ccgcgctcgc atccggcgac gtcaaggtcg gcgtgatcgg ttccagcccg       300
     ctcgcggcgg ccgtgagtca gggcctcgat ctgcaactct tctggatcct cgacaacatc       360
     aaccaggccg aagcgatggt ggtgcgcaac ggttccggca tcaccaagcc cgcggacctg       420
     aagggcaaga ccatcggcgt gccgttcgtt tcgacgaccc actatcacac catgttcgcg       480
     ctgcagcact ggggcatcaa tccgtccgac ctgaagattc tcaacatgca gcccaatcag       540
     atcgtcgcgg cctggtcgcg cggcgatatc gacgccgcct atgtgtggga ccccgcactc       600
     gccgaactga agaaaagcgg caaggtgttg atcacctccg gcgacctttc gaaactcggc       660
     aagccgacct tcgacggcat tgcggtcgat cgcaaatggg gcgaggaaca caaggacttc       720
     atggccaaac tcgtcaaggc gatcgccgac gccgaccagc aataccgcag caatccttcg       780
     caatggaacg cgagctcgcc gcaagccgcc gccatcgcga agatgatcgg cggctcgccg       840
     gctgacgtgc cggcctcgct ggcgctctat gcgttcccca cgcttagcga acaggcatcc       900
     gcgcaatggc tgggcggcgg tacgacgagc cgcgccgcgc tcgcgctgaa ggacacctcg       960
     gagttcctga agagccagaa gcagatcggc accgtgttgc cggactactc caaattcgtg      1020
     acgccggcct atgctgaagc cgccgcgcag ctcaaatga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page