(data stored in ACNUC7421 zone)

EMBL: CP001053.PE376

CP001053.PE376       Location/Qualifiers
FT   CDS_pept        431369..432895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4374"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG:
FT                   bxe:Bxe_B0695 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4374"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18751"
FT                   /db_xref="GOA:B2TF80"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF80"
FT                   /protein_id="ACD18751.1"
FT                   /translation="MSSRTATALWTQRFQRPTDSNMSLQGQIRQMLVAAILDGQLPPQT
FT                   ALPSSRELADQLSVARNTVVLAYQQLVEEGYLISRERSGHFVNPAMLEGRHGFKAVHTV
FT                   PGSEQEHASARPDWAQRVQRRPSAQRNIVKPGNWQDYEFPFIYGQFDQSLFPTNDWREC
FT                   CMKSLSVMEIRNWAPDLIGRDDDTLIQQIRTRVLPRRGVFAMPDEIVITMGCQQALYLI
FT                   ADLLARERTTVGFENPGYPDARNIFENRNAQLIPLPVDEGGVRPVDDAHLFAQCDYVYV
FT                   TPSHQCPTTATMPIERRHALLELAQKHDFVLIEDDYESENNFSGLPHPALKSLDKADRV
FT                   IYIGSLSKTFAPGLRLGYIVGPRELVQELRALRRLMVRHPAAYIQRAFATFLSLGHHDA
FT                   LLRRLAHAYRERALALMAALDTHMPEARHIPITGGASCWVQGPPWLDAVRLADDAEQHG
FT                   ILIELGGVFFMDGLEQKNCFRMGFSAIKLDKIDAGVRLLAELVRKQKPAL"
     atgtccagcc gtacagcgac ggcgctttgg acgcagcggt tccagcgtcc aaccgactcg        60
     aacatgagcc tgcaagggca gatccgccag atgctggtgg ccgcgattct ggacggccag       120
     ctgccgccgc agaccgcgct gccgtccagc cgggaactgg ccgatcaact gagcgtcgcg       180
     agaaatacgg tcgtgctggc gtaccagcaa ctcgtggagg agggctatct gatttcgcgc       240
     gagcgcagcg ggcacttcgt caatccagcg atgctggagg gacgccacgg cttcaaagcg       300
     gtgcacacgg tgcccggcag cgagcaggag cacgcgagcg cgcgccccga ttgggcccag       360
     cgtgtacaac ggcggccgtc cgcgcagcgc aacatcgtca agcccggcaa ctggcaggat       420
     tacgaatttc cctttatcta cgggcaattc gaccagtcgc tctttccgac caacgactgg       480
     cgcgaatgct gtatgaagtc actgtcggtg atggagatcc gcaactgggc gcccgatctg       540
     atcggccgcg acgacgacac gctgatccag cagatccgca cgcgcgtact gccgcgccgc       600
     ggcgtgtttg cgatgccgga tgagatcgtc atcacgatgg gctgccaaca ggcgttatat       660
     ctgatcgccg atctgctggc gcgcgaacgc accacggtag gctttgagaa ccccggctat       720
     ccggacgcgc gcaatatctt cgagaaccgc aacgcgcaac tgataccgct gccggtcgat       780
     gaaggcggcg tgcgcccggt cgacgacgcg cacctgttcg cccaatgcga ctacgtgtac       840
     gtgacgccga gccaccagtg ccccactacg gccaccatgc cgatcgaacg ccggcatgcc       900
     ttgctcgaac tcgcgcagaa gcacgacttc gtgctgatcg aagacgacta cgaaagcgaa       960
     aacaatttct cgggcctgcc gcatccggcg ctcaagagtc tggacaaggc cgaccgtgtg      1020
     atctacatcg gcagtctgtc gaagacgttc gcgcccggcc tgcggctcgg ctatatcgtc      1080
     ggtccgcgcg aactggtgca ggaattgcgc gcgttgcgcc ggctcatggt gcggcatccg      1140
     gcagcctaca ttcagcgcgc gttcgcgacg tttctctcgc tcggtcatca cgacgcactg      1200
     ctgcgccggc tggcccacgc ttatcgcgag cgcgcgctgg cgctgatggc ggcgctcgat      1260
     acccacatgc ccgaagcgcg tcacatcccg attacgggcg gggcctcatg ctgggtgcaa      1320
     ggtccgccct ggctcgacgc cgtgcgtctt gcagacgacg ccgaacagca cggcattctg      1380
     atcgaattgg gcggcgtgtt cttcatggac ggcctggagc agaagaactg cttccggatg      1440
     ggcttttctg cgatcaagct cgacaagatc gacgccggcg tgcgcctgct ggccgaactc      1500
     gtgcgcaagc agaagcccgc gctttaa                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page