(data stored in ACNUC7421 zone)

EMBL: CP001053.PE377

CP001053.PE377       Location/Qualifiers
FT   CDS_pept        complement(432938..433690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4375"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bxe:Bxe_B0696 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4375"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18752"
FT                   /db_xref="GOA:B2TF81"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF81"
FT                   /protein_id="ACD18752.1"
FT                   /translation="MTKADTPTLRAFALLEHLVNSDGPVSLADIAQDVALPKASLHRML
FT                   ASLEAGGLVIREPGQKNAYVIGPRLAQLALGVVMHSGARRLRHAILARLVADLGETCNL
FT                   TMLHETEVLYLDRMEAPWPLRLDLKPGSHVPAYCSASGKLLLAMLPREQRSALVRALKL
FT                   ERFTQNTITDPELLEAELDRTAHKRIAIDNEEFLAGIVCVAAPVIDENGTCIAAIAVHA
FT                   PVSRAPLSRALEFVPRLQEAAKELAATF"
     atgaccaaag cggatactcc gacgctgcgc gcgtttgcgt tgctcgaaca cctcgtcaac        60
     tcggacggcc cggtttcgct tgccgacatc gcgcaagacg tggcgctgcc caaggcgtcg       120
     ctgcatcgca tgctcgcttc gctcgaggcg ggcgggctcg tgattcgcga gcccggccag       180
     aaaaacgcgt atgtgatcgg accgcggctc gcacagcttg cgttgggtgt ggtgatgcat       240
     tccggcgcgc ggcgcctgcg tcatgcgatc ctcgcgcgtc tggtggccga tctcggcgag       300
     acctgcaatc tcaccatgct gcacgaaacc gaggtgttgt acctcgaccg catggaagcg       360
     ccgtggccgt tgcggctcga tctcaaaccc ggctcgcacg tgcccgcgta ttgcagcgcg       420
     agcggcaagc tgctgctcgc catgctgccg cgcgaacaac gctcggcgct ggtgcgcgcg       480
     ctgaagctcg aacgcttcac gcagaacacc attaccgatc cggaactgct ggaggcggaa       540
     ctcgaccgca ccgcgcacaa gcgtattgca atcgataacg aggagtttct ggccggcatc       600
     gtgtgcgtcg cggcgccggt gatcgatgag aacggcacct gtatcgcggc aatcgccgtg       660
     catgcgccgg tctcgcgcgc accgctctct cgcgcgctcg aattcgtgcc gcgccttcag       720
     gaagccgcca aggaactcgc ggcaaccttc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page