(data stored in ACNUC7421 zone)

EMBL: CP001053.PE38

CP001053.PE38        Location/Qualifiers
FT   CDS_pept        43294..43542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4027"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18413"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE92"
FT                   /protein_id="ACD18413.1"
FT                   /translation="MRQAFNIAVVLLLGYLMADRALMRAQAGEMGTITCHQGAEMVKSN
FT                   ALKKGFGDIGASSQGENFLSSCLVTGRGQVGDLIARD"
     atgagacaag cgttcaatat tgccgtagtg ctgttgctcg gctatctgat ggcagataga        60
     gcgctgatgc gcgcgcaagc gggcgagatg gggacaataa cgtgtcacca gggcgcggag       120
     atggtcaaat cgaacgcgct gaaaaaaggc ttcggagaca tcggggcaag cagccaaggc       180
     gagaattttc tatcgagctg tctcgtcacc gggcgcggtc aagtgggcga tctcatcgcg       240
     cgagactga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page