(data stored in ACNUC7421 zone)

EMBL: CP001053.PE380

CP001053.PE380       Location/Qualifiers
FT   CDS_pept        436696..438006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4378"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bxe:Bxe_B0699 major
FT                   facilitator superfamily (MFS)metabolite/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4378"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18755"
FT                   /db_xref="GOA:B2TF84"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF84"
FT                   /protein_id="ACD18755.1"
FT                   /translation="MAIDPRAIRRVAFASVIGATVEWYDFFLYGVVAGIVFNKLYFPAS
FT                   DPLVSTLLAYSTFAVGFVTRPLGGVIFGHFGDRIGRKSALILTLIIMGISTAGVAFVPT
FT                   YAQIGIWAPILLLSLRVLQGIGLGGEWGGAVLMAYEYAPPEKRGLYASLPQIGLSIGLC
FT                   LASGMVAALSRLLPETAFLSWGWRIAFGASLGLVLIGLYIRAKVMETPEFIALKRNRRE
FT                   AKIPFVDMITRYRGAVVLGMGARYIDGVFFNIFAVFSIGYLTQHVSMSRTDALLGVMIA
FT                   AGVMCFFIPLFGSMSDKLGRARVYFWGSLICGVSVFPAFWLIEMQPANTLLIWAAIVVP
FT                   FGIFYAMVYGPEAALFAELFDAEVRYTGISFVYQFSGIFASGLTPIIATILMRLNGGKP
FT                   WTVCAYVLFSALVSALSVRAIERRRAGAFESVVHARS"
     atggcaatcg atccccgcgc tatccggcgc gttgcgttcg ccagtgtgat cggcgcaacc        60
     gtcgaatggt atgacttttt tctttacggc gtggtcgccg gcatcgtatt caacaagctc       120
     tattttccgg ccagcgatcc gctcgtatcg acgctgctcg cctattcgac cttcgcagtc       180
     ggcttcgtga cgcggccttt gggcggcgtg atattcggtc acttcggcga tcggatcggg       240
     cgtaaatcgg cgttgattct gacgctcatc atcatgggga tctcgacggc gggcgtcgcg       300
     ttcgttccca cttatgcgca gatcggcatc tgggcaccga ttctgttgtt gtcgctgcgc       360
     gtgttgcagg gcatcgggct cggcggcgaa tggggcggcg cggtgctgat ggcgtatgaa       420
     tacgcgccac ctgaaaagcg cggcctgtac gcgagcctgc cgcagatcgg tttgtcgatc       480
     ggactctgtc tcgcatcggg gatggtcgcc gcgctctccc gcctgctgcc cgaaacggcg       540
     ttcctgtcgt gggggtggcg gatcgcgttc ggcgcgtcgc tcggtctggt tttgattggc       600
     ctgtacattc gcgccaaggt gatggagacg cccgaattca tcgcactcaa acgcaatcgg       660
     cgcgaagcga agattccgtt cgtcgacatg atcacgcgtt atcgcggcgc cgtggtgctc       720
     ggcatgggcg cgcgttatat cgacggcgtg ttcttcaaca tcttcgccgt gttctcgatc       780
     ggctacctca cgcagcacgt gtcgatgagc cgcaccgatg ccttgctcgg cgtgatgatc       840
     gcggccggcg taatgtgctt ttttatcccg ctgttcggca gcatgtcgga taagctcggc       900
     cgcgcgcggg tgtatttctg gggctcgctg atttgtggcg tgtcggtgtt tccggctttc       960
     tggctcatcg aaatgcaacc ggccaacacg ctgttgattt gggcggccat cgtggtgccg      1020
     ttcggcattt tctacgcgat ggtgtacggg ccggaggcgg cattgtttgc cgaactgttc      1080
     gatgccgaag tgcgttatac gggcatctcg ttcgtgtatc agttctcggg aatcttcgcg      1140
     agcgggctca cgccgatcat cgcgacgatc ctgatgcggt tgaatggcgg taagccatgg      1200
     actgtgtgcg cgtatgtgtt gttttcggct ttggtatcgg cgttgtcggt gcgcgcgata      1260
     gagcggaggc gggcgggcgc gttcgaatcg gtggtgcatg cgcggtcgtg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page