(data stored in ACNUC7421 zone)

EMBL: CP001053.PE382

CP001053.PE382       Location/Qualifiers
FT   CDS_pept        complement(438503..438733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4380"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: reu:Reut_C6345
FT                   prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4380"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18757"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF86"
FT                   /protein_id="ACD18757.1"
FT                   /translation="MLTVNIHEAKTNFSRLVDAAAGGEEILIAKAGKPAARLVSITKPA
FT                   RRFGALKGAVRIADDFDAPLPDDVIAAFEGN"
     atgttgacag tcaatattca tgaagcaaag actaattttt cgcggttggt cgacgccgct        60
     gctggcggcg aggaaatcct gatcgcaaaa gccggcaagc cggcggcgcg tctggtctcc       120
     atcacgaagc ctgcccggcg ctttggcgcc ctcaaaggcg cggtacgcat cgcggatgac       180
     tttgacgcac ctttacctga tgacgtgatc gcagcattcg agggcaattg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page