(data stored in ACNUC7421 zone)

EMBL: CP001053.PE383

CP001053.PE383       Location/Qualifiers
FT   CDS_pept        complement(438866..439630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4381"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bxe:Bxe_B0700 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4381"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18758"
FT                   /db_xref="GOA:B2TF87"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF87"
FT                   /protein_id="ACD18758.1"
FT                   /translation="MSTSNQSNAAAVRAFRVLETLAEAGSPLSMTELVNALGLPKQTVH
FT                   RILVQLMDAWLVTRGAGDRLYECSPRVRMLAVNVLMHAGPAAARHVLLEQLVAKIGETC
FT                   NLTMLSGNDVVYVDRVETEWPLRMHLQPGSHVPLHCSASGKLLLSFLPKDRRERVIETL
FT                   PLRGYSERTITDRDALRKELSTTRRRLLAINNQEHLQGLIAIAVPVMLDRNRACAAIAV
FT                   QAPVGRVTLDDLLAFVPDLRHAAEETAKTFQE"
     atgtcgacgt caaaccagtc gaatgcagct gcagtgcgcg cgtttcgcgt actcgaaacg        60
     cttgccgaag cgggcagccc gctttcgatg acggagctcg tcaatgcgct cggtctgccc       120
     aagcagaccg ttcaccgcat cctcgtgcaa ttgatggatg cgtggctcgt cacacgcggc       180
     gcgggcgacc gactttacga atgttcgcca cgcgtgcgca tgctcgcggt caatgtgttg       240
     atgcatgcgg gaccggccgc cgcgcgtcat gtgctgctcg aacagctagt ggcgaaaatc       300
     ggtgagacct gcaacctgac catgctgtcg ggcaacgatg tggtctacgt ggatcgtgtc       360
     gaaaccgagt ggccgctacg catgcatttg cagccgggtt cccacgtgcc gctgcactgc       420
     tcggcaagcg gcaagctgct gctgagcttt ctgccgaagg accggcgcga acgcgtgatc       480
     gagacgctgc cgttgcgtgg ttattcggaa cggacgatca ccgatcgcga cgcattgcgc       540
     aaggaattga gcaccacgcg gcggcggttg cttgcgatca acaaccagga acatctgcaa       600
     gggctgatcg cgattgccgt gccggtgatg ctggatcgca atcgcgcctg cgcggcgatt       660
     gccgtgcagg cgccggtggg cagagtcacg ctggatgatc tgctcgcgtt tgtgcctgat       720
     ttgcgccacg cggcggaaga gacggcgaag acgtttcaag aatga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page