(data stored in ACNUC7421 zone)

EMBL: CP001053.PE387

CP001053.PE387       Location/Qualifiers
FT   CDS_pept        444824..445156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_6287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4385"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18762"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF91"
FT                   /protein_id="ACD18762.1"
FT                   /translation="MKFRKVFVIGLLGAFLSPLALADVGHASPGHAPVKQDGSYGSVPQ
FT                   TTLPSSAAPVVKPAAQGKTRAEVRQELLQAYKDGLIPTTEADYPPSKRTIERNKALFAE
FT                   TERYLE"
     atgaagtttc gaaaagtatt tgtcattggg ctgcttggcg cttttttatc cccgctggct        60
     ttagcggacg tggggcacgc gtcccccggc cacgcacccg tcaagcaaga tgggagttac       120
     ggcagcgtac cgcaaaccac tctgccgtcg agtgccgcac cggtggtcaa accggcggct       180
     cagggaaaga cacgcgctga agttcgtcag gagctgcttc aagcatataa ggacggtctc       240
     ataccgacga ccgaagccga ctatccgccg agcaaacgga ctatcgagcg caataaggca       300
     ctgtttgccg aaaccgaacg ctacctcgag taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page